KEGG   Rhodopseudomonas palustris DX-1: Rpdx1_0679Help
Entry
Rpdx1_0679        CDS       T01381                                 

Definition
(GenBank) Nitrilase/cyanide hydratase and apolipoprotein N-acyltransferase
  KO
K11206  deaminated glutathione amidase [EC:3.5.1.128]
Organism
rpx  Rhodopseudomonas palustris DX-1
Brite
KEGG Orthology (KO) [BR:rpx00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    Rpdx1_0679
Enzymes [BR:rpx01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.128  deaminated glutathione amidase
     Rpdx1_0679
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CN_hydrolase
Motif
Other DBs
NCBI-ProteinID: ADU42316
UniProt: E6VMD3
Position
727456..728331
Genome map
AA seq 291 aa AA seqDB search
MTEAVPFNAALVQMRSGLTPEPNLEQGIRLIREAAAAGADYVLTPEVSNMMQLNREALFA
QLADQDSDASLKAYRELARELNIHLHIGSLALRASPERAVNRSFLIGPDGTILASYDKIH
MFDIDLGNGESYRESANYQPGETAVISDLPWGRIGLTICYDVRFPALYRALAEAGASFLT
VPAAFTKPTGEAHWHVLLRARAIENGCFVFAAAQGGLHENKRETFGHSLIIDPWGVVLAE
GGLEPGFIMARIDPAEVTKARGKIPSLQHGRRFTVADGNAGPGHLHLVRQS
NT seq 876 nt NT seq  +upstreamnt  +downstreamnt
atgaccgaagcggtgccgttcaatgccgccctggtgcagatgcgcagcggcctcaccccc
gagcccaatctcgagcagggcatccggctgatccgcgaggcggccgcggccggcgccgac
tacgtgctcacccccgaggtgagcaacatgatgcagctcaaccgtgaagcgctatttgcc
cagctcgccgaccaagacagcgacgcttcgttgaaggcgtatcgcgagctggcacgcgag
ctgaacatccatctgcacatcggctcgctggcgctgcgcgcctcgccggagcgcgcggtc
aaccgctcgttcctgatcggcccggacggcacgatcctggcgagctacgacaagatccac
atgttcgacatcgatctcggcaatggcgagagctaccgggagtcggcgaactaccagccc
ggcgagaccgcggtgatctccgatctgccgtggggccggatcggcctgacgatctgctac
gacgtgcggtttccagcgctgtaccgggcgctggcggaagccggcgcgtcgttcctcacg
gttccggcggccttcaccaagcctaccggcgaggcgcattggcacgtgctgctgcgggcc
cgcgcgatcgagaacggctgcttcgtgttcgccgcggcgcagggcggcctgcacgagaac
aagcgcgagaccttcggtcattcgctgatcatcgatccgtggggcgtggtgttggccgaa
ggcggcctcgagcccggcttcatcatggcgcggattgatccggccgaggtgacgaaagcg
cgcggcaagatcccgtcgctgcagcacggccgccgcttcaccgtcgccgatggcaatgcg
ggccccggccatctgcatctggtccggcagtcatga

DBGET integrated database retrieval system