KEGG   Rhodopseudomonas palustris DX-1: Rpdx1_1933Help
Entry
Rpdx1_1933        CDS       T01381                                 

Definition
(GenBank) Amidase
  KO
K02433  aspartyl-tRNA(Asn)/glutamyl-tRNA(Gln) amidotransferase subunit A [EC:6.3.5.6 6.3.5.7]
Organism
rpx  Rhodopseudomonas palustris DX-1
Pathway
rpx00970  Aminoacyl-tRNA biosynthesis
rpx01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:rpx00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    Rpdx1_1933
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:rpx03029]
    Rpdx1_1933
Enzymes [BR:rpx01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.6  asparaginyl-tRNA synthase (glutamine-hydrolysing)
     Rpdx1_1933
    6.3.5.7  glutaminyl-tRNA synthase (glutamine-hydrolysing)
     Rpdx1_1933
Mitochondrial biogenesis [BR:rpx03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    Rpdx1_1933
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Amidase 2_5_RNA_ligase2
Motif
Other DBs
NCBI-ProteinID: ADU43544
UniProt: E6VNC5
Position
complement(2068163..2069578)
Genome map
AA seq 471 aa AA seqDB search
MSDGLATTATALHDLSATELLAGYYGKQFSPSEVMEAVIAQATRWEPHINALYGFDPDTA
RKAAQASTARWAKGEPLGLLDGVPVTIKENVATEGVPVPLGVPITPLTPAAADAPPAARL
REAGGILWSKTTMPDFGMLSSGLSSFHGVTRNPWDVSQNTGGSSAGAGAAGAAGYGPLHL
GTDIGGSVRLPAAWCGIFALKPSLGRVPIDPPYVGRCAGPMTRTVDDAALMMSVLSQPDG
RDGMSLPPHDFDWSELDVDVRGKKIGLLTDLGFGMELEDEVRDIVTQAARTFEAQGAIVE
PVGLGFTREMMDGLDAFWRARMWSDLAQFSDEQRARVLPYIVRWAEPGARLSGVEVIRGF
NQTMAMRALGAKLFAGIDYLISPVAPVVSFAADVASPWNDPDRPFDHILYTVPWNMAENP
AASINGGYSTKGFPIGVQIVGKRFDDLGVLRMAKAFESLRGEQKPWPVVPR
NT seq 1416 nt NT seq  +upstreamnt  +downstreamnt
atgtctgacggcctcgccaccaccgccaccgcgctacatgacctctcggccaccgaactg
ctcgccggctattacggcaagcagttctcgccgagcgaggtgatggaagcggtgatcgcc
caggcgacgcgctgggagccgcatatcaatgcgctgtacggattcgatcccgacaccgcg
cgcaaggcggcgcaagcctccaccgcgcgctgggccaagggcgagccgctcggcctgctc
gacggcgtgccggtgacgatcaaggagaacgtcgccaccgaaggcgtgccggtgccgctc
ggcgtgccgatcacgccgctgacgccggccgcggccgatgcgccgcccgccgcacggctg
cgcgaagccggcggcattctgtggagcaaaacgacgatgccggatttcggcatgctgtcg
tcgggcctctccagcttccacggcgtcacccgcaatccgtgggacgtgtcgcagaacacc
ggcggctcctccgccggcgccggcgctgcgggcgcggccggctacgggccgctgcatctc
ggcacagatatcggcggctcggtgcggctgccggcggcgtggtgcggcatcttcgcgctg
aagccgagcctcggccgcgtgccgatcgatccgccctatgtcggccgctgcgccgggccg
atgacccgcaccgtcgacgacgccgcgctgatgatgagcgtgctgtcgcagcccgacggc
cgcgacggcatgagcctgccgccgcacgatttcgactggagtgagctcgacgtcgatgtg
cgcggcaagaaaatcggcctgctcaccgatctcggcttcggcatggagctggaagacgag
gtacgcgacatcgtcacgcaggcggcgcgtacattcgaggcgcagggcgcgatcgtcgag
ccggtcgggctcggcttcacgcgcgagatgatggacgggctcgacgcgttctggcgggcg
cggatgtggagcgatctggcgcaattctccgacgagcagcgcgcacgcgtgctgccctac
atcgtgcgctgggccgagcccggcgcgcggctgagcggcgtcgaggtgatccgcggcttc
aaccagaccatggcgatgcgcgcgctcggcgccaagctgtttgccggcatcgactatctg
atctcgccggtggcgccggtggtgagcttcgccgccgatgtcgcgtcgccgtggaatgat
ccggaccggccgttcgatcacatcctctataccgtgccctggaatatggcggagaatccg
gccgcctcgatcaacggcggctacagcaccaagggtttcccgatcggcgtgcagatcgtc
ggcaagcgtttcgacgatctcggcgtgctgcgcatggcgaaggcgttcgaaagcttgcgc
ggcgaacagaagccgtggccggtcgtgccgcgctaa

DBGET integrated database retrieval system