KEGG   Rhodopseudomonas palustris DX-1: Rpdx1_3503Help
Entry
Rpdx1_3503        CDS       T01381                                 

Definition
(GenBank) phosphatidylserine decarboxylase related protein
  KO
K01613  phosphatidylserine decarboxylase [EC:4.1.1.65]
Organism
rpx  Rhodopseudomonas palustris DX-1
Pathway
rpx00564  Glycerophospholipid metabolism
rpx01100  Metabolic pathways
rpx01110  Biosynthesis of secondary metabolites
Module
rpx_M00093  Phosphatidylethanolamine (PE) biosynthesis, PA => PS => PE
Brite
KEGG Orthology (KO) [BR:rpx00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    Rpdx1_3503
Enzymes [BR:rpx01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.65  phosphatidylserine decarboxylase
     Rpdx1_3503
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PS_Dcarbxylase PsbT
Motif
Other DBs
NCBI-ProteinID: ADU45072
UniProt: E6VD03
Position
complement(3743971..3744669)
Genome map
AA seq 232 aa AA seqDB search
MSIVNSVRAQIPPIHREGYPFVGGFALATLILFWIWSPLGWIGTVLTIWCAYFFRDPART
TPVRDGLVVSPADGRVSMVVDIIPPPELGLGAKPLPRVSIFMSVFNCHVNRSPVAGRIER
IVYSPGKFVNAELDKASEDNERNSMVLSTEHGQIGVIQIAGLVARRIVSFVREGQPLVAG
ERFGLIRFGSRLDVYLPEGTKPLVAEGQTAFAGETVLADLKGSDAGRTFRTD
NT seq 699 nt NT seq  +upstreamnt  +downstreamnt
atgtccatcgtcaattccgtccgcgcccagatcccgccgattcaccgggagggctatccg
ttcgtcggcggcttcgctctggcgaccctcattctgttctggatctggtcgccgctcggc
tggatcggcaccgtgctgacgatctggtgcgcctatttcttccgcgatccggcgcgcacg
accccggtccgcgacgggctggtggtatcgccggccgatggccgggtgtcgatggtggtc
gatatcatcccgccgccggagctgggtctcggcgccaagccgttgccgcgggtctcgatc
ttcatgagcgtgttcaactgccacgtgaaccgcagcccggtggccggccggatcgagcgg
atcgtgtattcgccgggcaagttcgtgaacgccgaactggacaaggccagcgaagacaac
gagcgcaattcgatggtgctctccaccgaacacggccagatcggcgtgatccagattgcc
gggctggtcgcccggcggatcgtgtcgttcgttcgcgaggggcagcctctggttgccggc
gagcgattcggcctgatccggttcggctcgcggctcgacgtctatctgcccgagggcacc
aagccgctggtcgccgaagggcagaccgcgttcgccggcgaaaccgtgctggccgacctc
aagggcagcgacgccggccggacgttccggaccgattga

DBGET integrated database retrieval system