KEGG   Rhodopseudomonas palustris DX-1: Rpdx1_3603Help
Entry
Rpdx1_3603        CDS       T01381                                 

Definition
(GenBank) AMP-dependent synthetase and ligase
  KO
K01895  acetyl-CoA synthetase [EC:6.2.1.1]
Organism
rpx  Rhodopseudomonas palustris DX-1
Pathway
rpx00010  Glycolysis / Gluconeogenesis
rpx00620  Pyruvate metabolism
rpx00640  Propanoate metabolism
rpx00680  Methane metabolism
rpx01100  Metabolic pathways
rpx01110  Biosynthesis of secondary metabolites
rpx01120  Microbial metabolism in diverse environments
rpx01130  Biosynthesis of antibiotics
rpx01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:rpx00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Rpdx1_3603
   00620 Pyruvate metabolism
    Rpdx1_3603
   00640 Propanoate metabolism
    Rpdx1_3603
  Energy metabolism
   00680 Methane metabolism
    Rpdx1_3603
Enzymes [BR:rpx01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     Rpdx1_3603
Lipid biosynthesis proteins [BR:rpx01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   Rpdx1_3603
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding AMP-binding_C
Motif
Other DBs
NCBI-ProteinID: ADU45172
UniProt: E6VEM8
Position
complement(3864462..3866147)
Genome map
AA seq 561 aa AA seqDB search
MSNAHPAAAAIEDYADVLARFRREDLEALFDGDFATGINVCVECCDRHVAGGGTALDWES
QDGRTASFSFGQMQDYAARVANLLVAQGVKPGDVVAGMLPRTPELLALILGTWRAGAVYQ
PLFTAFGPKAIEHRVKMSAAKLVVTDVANRAKLADVADCPTVAIVLRPGETAPLGDLDFH
AEIAAQSTEFAPVLRKGTDLFLMMSTSGTTGLPKGVPVPINALPAFYSYIRDAVDLRPDD
IFWNIADPGWAYGLYYAVTGPLLHGHATTFYDGPFTAESTYGLIKRRGITNLAGAPTAYR
LLIAAGPEAAAPVKGQLRVVSSAGEPLNPEVIRWFAEHLAAPIHDHYGQTELGMVVNNHH
RLRHTVHPGSAGLAMPGFRVAVLDEQSNELPPNVPGVLSVDLKRSPLMWFSGYWQQETPA
IEGGYYRTGDTVELEPDGSISFVGRADDVITSSGYRIGPFDVESALIEHAAVIEAAVIGK
PDPERTEIVKAYVVLAKDVTPSEALAEELRQYVKKRLSAHAYPREIEFLEQLPKTPSGKL
QRFILRKRDTDPAQATSSAAV
NT seq 1686 nt NT seq  +upstreamnt  +downstreamnt
atgagcaacgcccatcctgcggcagcagccatcgaagattacgccgacgttcttgcgcgg
tttcgccgcgaggatctcgaagcgctgttcgacggcgacttcgcgaccggcatcaacgta
tgcgtcgaatgctgcgaccgtcacgtcgccggcggcggcacggcgctggattgggaaagc
caggacggccgcaccgcatcgttcagcttcggacagatgcaggactatgcggcccgcgtc
gccaatctgctggtcgcacagggcgtcaaacccggcgacgtcgtcgccggcatgctgccg
cgcacgcccgagctgctggcgctgatcctcggcacctggcgcgccggcgcggtgtatcag
ccgctgttcaccgcgttcggtccgaaggcgatcgagcaccgcgtcaagatgagcgccgcc
aagctggtggtcaccgatgtggccaatcgcgccaagctcgccgacgtcgccgattgcccg
accgtggcgatcgtgctgcggcccggcgagaccgcgccgctcggcgatctcgatttccat
gccgagatcgcggcgcaatcgaccgagttcgcgccggtgctgcgcaagggcaccgacctg
ttcctgatgatgtcgacctccggcaccaccggcctgccgaagggcgtgccggtgccgatc
aacgcgctgccggctttctattcgtacatccgcgatgcggtcgacctgcgccccgatgat
atcttctggaatatcgccgatcccggctgggcctacggcctgtactacgcggtgaccggt
ccgctcctgcacggccacgccaccaccttctacgacggtccgttcaccgccgagagcacc
tatggattgatcaagcgccgcggcatcaccaatctggccggcgcgccgaccgcgtatcgg
ctgctgatcgcggcgggaccggaagcggcggcgccggtgaagggccagctccgcgtcgtc
agcagcgccggcgagccgctcaatccggaagtcatccgctggttcgctgagcatctcgcc
gcgccgatccacgatcattacggccagaccgagctcggcatggtggtcaacaatcaccac
cggctgcgccacaccgtgcatccgggctccgcgggcctggcgatgccaggcttccgcgtc
gcggtgctcgacgagcagagcaacgaactgccgccgaacgtcccgggcgtgctcagtgtc
gacctgaagcgctcaccgctgatgtggttctccggctattggcagcaggagacgccggcg
atcgaaggcggttactaccgcaccggcgacaccgtcgagctggagccggatggctcgatc
agcttcgtcggccgggccgacgacgtcatcacctcgtcgggctaccggatcggtccgttc
gacgtcgagagtgcgctgatcgagcatgcggcagtgatcgaggcggcagtgatcggcaag
cccgatcccgagcgcaccgagatcgtcaaagcctatgtggtgctcgccaaggacgtgaca
ccgagcgaggcgctggccgaggagctgcggcaatacgtcaagaagcggctctcggcgcat
gcctatccgcgcgagatcgaattcctggagcaactgccgaagacgccgagcggcaagctg
cagcgcttcatcctgcgcaagcgcgacaccgaccccgcccaggccacctcgtctgccgca
gtttga

DBGET integrated database retrieval system