KEGG   Rhodopseudomonas palustris DX-1: Rpdx1_3821Help
Entry
Rpdx1_3821        CDS       T01381                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
rpx  Rhodopseudomonas palustris DX-1
Pathway
rpx00071  Fatty acid degradation
rpx00072  Synthesis and degradation of ketone bodies
rpx00280  Valine, leucine and isoleucine degradation
rpx00310  Lysine degradation
rpx00362  Benzoate degradation
rpx00380  Tryptophan metabolism
rpx00620  Pyruvate metabolism
rpx00630  Glyoxylate and dicarboxylate metabolism
rpx00640  Propanoate metabolism
rpx00650  Butanoate metabolism
rpx00900  Terpenoid backbone biosynthesis
rpx01100  Metabolic pathways
rpx01110  Biosynthesis of secondary metabolites
rpx01120  Microbial metabolism in diverse environments
rpx01130  Biosynthesis of antibiotics
rpx01200  Carbon metabolism
rpx01212  Fatty acid metabolism
rpx02020  Two-component system
Brite
KEGG Orthology (KO) [BR:rpx00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    Rpdx1_3821
   00630 Glyoxylate and dicarboxylate metabolism
    Rpdx1_3821
   00640 Propanoate metabolism
    Rpdx1_3821
   00650 Butanoate metabolism
    Rpdx1_3821
  09103 Lipid metabolism
   00071 Fatty acid degradation
    Rpdx1_3821
   00072 Synthesis and degradation of ketone bodies
    Rpdx1_3821
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    Rpdx1_3821
   00310 Lysine degradation
    Rpdx1_3821
   00380 Tryptophan metabolism
    Rpdx1_3821
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    Rpdx1_3821
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    Rpdx1_3821
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    Rpdx1_3821
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:rpx04147]
    Rpdx1_3821
Enzymes [BR:rpx01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     Rpdx1_3821
Exosome [BR:rpx04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Rpdx1_3821
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt ACP_syn_III
Motif
Other DBs
NCBI-ProteinID: ADU45386
UniProt: E6VHT3
Position
4100871..4102046
Genome map
AA seq 391 aa AA seqDB search
MAEAYIVAAARTAGGRKGGRLAGWHPVDLAASVINALVDRSGAAPDQIEDVIMGCVGQGG
EQAVNIGRNAVLASKLPESVPGTSVDRQCGSSQQALHFAAQAVMAGTMDIVIAAGVESMT
RVPMGSPSILAAKAGLGNYKSPKMEERYPNIQFSQFVGAEMVANKYNLSKDELDEFAFNS
HQRAIAATQGGKFKDEIIPLEITRADGSTDIHHIDEGIRFDATLDGIKGVKLINENGGKL
TAATASQICDGASGVVVVNEKGLKQLGVQPLARVHHMTMRGGDPVIMLEAPLPATEYALK
KAGMKIDDIDLFEVNEAFASIPAAWLKATGADPARLNVNGGAIALGHPLGGSGTKLMTTL
IHALKQNNKRYGLQTMCEGGGMANVTIVERL
NT seq 1176 nt NT seq  +upstreamnt  +downstreamnt
atggccgaggcctatatcgtcgccgctgcccgcaccgccggcggccgcaagggaggtcgt
ctggccggctggcatccggtcgatctcgccgcctcggtcatcaacgcgctggtcgaccgc
tcgggcgccgcgccggatcagattgaagacgtgatcatgggctgcgtcggccagggcggc
gagcaggccgtcaatatcggccgcaacgcggtgctggcctcgaagctgccggaaagcgtg
ccgggcacgtcggtcgaccggcagtgcggctcgtcgcagcaggcgctgcatttcgccgca
caggcggtgatggccggcaccatggatatcgtgatcgctgccggcgtcgagtcgatgacc
cgcgtgccgatgggctcgccgagcattctcgccgccaaggccgggctcggtaactacaag
agcccgaagatggaagagcgctacccgaacatccagttcagccagttcgtcggcgccgaa
atggtggcgaacaagtacaacctgtcgaaggacgaactcgacgaattcgcgttcaacagc
caccagcgcgcgatcgccgcgacgcaaggaggcaagttcaaggacgagatcatcccgctc
gagatcacccgcgccgacggctcgaccgacatccaccatatcgacgaaggcatccgcttc
gacgccacactcgacggcatcaagggcgtcaagctgatcaacgagaacggcggcaagctg
accgcggcgaccgccagccagatctgcgacggcgcctccggcgtggtggtagtcaacgag
aagggcctgaagcagctcggcgtgcagccgctcgcccgcgttcatcacatgacgatgcgc
ggcggcgatccggtgatcatgctggaagccccgctgcccgccaccgaatacgcgctgaag
aaggccgggatgaagatcgacgacattgatctgttcgaggtcaacgaagccttcgcctcg
atcccggccgcgtggctgaaggcgaccggcgccgatccggcccggctcaacgtcaacggc
ggcgcgatcgcgctcggccatccgctcggcggctcaggcaccaagctcatgaccaccctg
atccacgcgctgaagcagaacaacaagcgctacggcctgcagacgatgtgcgagggcggc
ggcatggccaacgtcaccatcgtcgagcggctgtaa

DBGET integrated database retrieval system