KEGG   Rhodopseudomonas palustris DX-1: Rpdx1_4585Help
Entry
Rpdx1_4585        CDS       T01381                                 

Definition
(GenBank) two component transcriptional regulator, winged helix family
  KO
K07659  two-component system, OmpR family, phosphate regulon response regulator OmpR
Organism
rpx  Rhodopseudomonas palustris DX-1
Pathway
rpx02020  Two-component system
Brite
KEGG Orthology (KO) [BR:rpx00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    Rpdx1_4585
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02022 Two-component system [BR:rpx02022]
    Rpdx1_4585
Two-component system [BR:rpx02022]
 OmpR family
  EnvZ-OmpR (osmotic stress response)
   Rpdx1_4585
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Response_reg Trans_reg_C MOSC GerE
Motif
Other DBs
NCBI-ProteinID: ADU46135
UniProt: E6VC82
Position
complement(4923637..4924359)
Genome map
AA seq 240 aa AA seqDB search
MIQLAALAKKPVRPADDAPHLLLVDDDRRIRDLLSRFLASEGYRVTTAQSVRDARAKLAG
LDFDLLILDVMMPGETGFDLARSIRETSDVPIVMLTARHEAESRIEGLQIGADDYVAKPF
EPRELLLRIGNILKRTAPAPAAKAETVAFGPYVFHIERGELRQGDEIVHLTDRERDMLRM
LAAAPGETVPRGDLSGAGNANERAVDVQINRLRRKIERDPANPLFLQAVRGIGYRLVAAP
NT seq 723 nt NT seq  +upstreamnt  +downstreamnt
gtgatccagctcgcagcactggcgaagaaaccggtccgccccgccgacgatgcgccgcat
ctgctgctggtcgacgacgaccgccggatccgcgatctgctgtcgcggtttctcgcctcc
gagggctaccgcgtcaccaccgcgcagagcgtgcgcgacgcccgcgccaagctggcgggg
ctcgacttcgacctcttgatcctcgacgtgatgatgccgggcgagaccggcttcgatctc
gcccgctcgatccgcgaaacctcggacgtgccgatcgtgatgctcaccgcccggcacgag
gcggagagtcggatcgaggggctgcagatcggcgccgacgactacgtcgccaagccgttc
gagccgcgcgaattgctgctgcggatcggcaatatcctcaagcgcaccgcgccggcgccg
gccgccaaggccgagacggtggcgttcgggccttacgtgtttcacatcgagcgcggcgaa
ctgcgccagggcgacgagatcgttcacctgaccgaccgcgagcgcgacatgctgcggatg
ctggcggcggcccccggcgaaaccgtgccgcgcggcgatctatccggcgccggcaacgcc
aatgagcgcgcggtcgacgtccagatcaatcggctgcgccgtaagatcgaacgcgacccc
gccaacccgctgttcctgcaagccgtccgcggcatcggctatcgcctggtggcggcgccg
tag

DBGET integrated database retrieval system