KEGG   Rhodococcus pyridinivorans: Y013_04480Help
Entry
Y013_04480        CDS       T02974                                 

Definition
(GenBank) malate synthase
  KO
K01638  malate synthase [EC:2.3.3.9]
Organism
rpy  Rhodococcus pyridinivorans
Pathway
rpy00620  Pyruvate metabolism
rpy00630  Glyoxylate and dicarboxylate metabolism
rpy01100  Metabolic pathways
rpy01110  Biosynthesis of secondary metabolites
rpy01120  Microbial metabolism in diverse environments
rpy01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:rpy00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    Y013_04480
   00630 Glyoxylate and dicarboxylate metabolism
    Y013_04480
Enzymes [BR:rpy01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.9  malate synthase
     Y013_04480
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Malate_synthase
Motif
Other DBs
NCBI-ProteinID: AHD19983
UniProt: V9XC71
Position
945677..947860
Genome map
AA seq 727 aa AA seqDB search
MTERVQVGGLQIAQVLYDFINNEAIPGSGVDADTFWAGTDKIVHDLAPKNRALLAKRDDL
QAKIDGWHRDRAGQPHDPVAYKAFLEEIGYLVPTPEPFTIGTENVDTEIAETAGPQLVVP
VLNARFALNASNARWGSLYDALYGTDVIPEEGGAEKGTGYNKVRGDKVIAWARDFLDKAA
PLAQGSHADSTGYSIDGTELKVTLEGGTVTGLAQPDKLVGYLGDKATPSSVLLRNHGLHI
EIQIDPESPIGSTDAAGVKDVVLESAVTTIMDFEDSVAAVDADDKVVGYRNWLGLNRGDL
SESFDKGGKTLTRKLNPNRVYTALDGSDLELHGRSLLFVRNVGHLMTNPAILDRDGNEVP
EGILDALITSLCAIHGLHIDEDHGPLANSRTGSIYIVKPKQHGPEESAFTTELFGRVEEV
LSLPTNTLKVGIMDEERRTTVNLAACIKAASDRVVFINTGFLDRTGDEIHTSMEAGPVVR
KAAMKQQRWIAAYEDWNVDTGLACGLQGKAQIGKGMWAMTDLMRDMVEQKIGQPKAGANT
AWVPSPTGATLHATHYHEVDVFAVQNELQGKSRATVDDILTIPLAENPNWSAEEKREELD
NNCQSILGYVVRWIDQGVGCSKVPDIHDVALMEDRATLRISSQLLANWIRHDVVTADDVV
ASLERMAPVVDRQNEGDPGYRPLAPNFDDSIAFQAAKELILEGTTQPSGYTEPILHRRRR
EYKAKYA
NT seq 2184 nt NT seq  +upstreamnt  +downstreamnt
atgacagaacgcgtgcaggtcggcggactccagatcgcgcaggttctctacgacttcatc
aacaacgaggccatccccggcagcggggtcgacgcggacaccttctgggcgggtaccgac
aagatcgtccacgacctcgcccccaagaaccgggcactgctcgccaagcgtgacgacctc
caggccaagatcgacggctggcaccgcgaccgcgccggacagccccacgaccccgtcgcc
tacaaggccttcctcgaagagatcggctacctcgtccccacccccgaaccgttcaccatc
ggcaccgagaacgtcgacaccgagatcgccgagaccgccggtccgcagctcgtcgtgccc
gtcctcaacgcccgcttcgcgctcaacgcttccaacgcgcggtggggatcgctctacgac
gcgctctacggcaccgacgtcatccccgaagagggcggcgccgagaagggcaccggctac
aacaaggtccgcggcgacaaggtcatcgcctgggcccgcgacttcctcgacaaggccgca
cccctcgcgcaaggctcgcacgccgactccaccggctacagcatcgacggcaccgaactg
aaagtcaccctcgagggcggcaccgtcaccggactcgcccagcccgacaagctcgtcggc
tacctcggcgacaaggccaccccctcctcggtgctgctgcgcaaccacggtctgcacatc
gagatccagatcgaccccgaatcccccatcggcagcaccgacgccgccggcgtcaaggac
gtcgtcctcgaatccgccgtcaccaccatcatggacttcgaggactccgtcgccgccgtc
gacgccgacgacaaggtcgtcggctaccgcaactggctcggcctcaaccgcggcgacctg
tccgagtccttcgacaagggcggcaagaccctcacccgtaagctgaacccgaaccgcgtc
tacaccgccctcgacggcagcgacctcgaactgcacggccgctccctgctgttcgtccgc
aacgtcgggcacctcatgaccaaccccgccatcctcgaccgcgacggcaacgaggtcccc
gaaggcatcctcgacgcgctcatcaccagcctgtgcgccatccacggcctgcacatcgac
gaggaccacggcccgctcgccaacagccgcaccggctcgatctacatcgtcaagcccaag
cagcacggccccgaggaatccgccttcaccaccgaactgttcggccgcgtcgaagaggtc
ctctccctgcccaccaacaccctcaaggtcggcatcatggacgaggagcgacgcaccacc
gtcaacctcgccgcctgcatcaaggccgcctccgaccgcgtggtcttcatcaacaccggc
ttcctcgaccgcaccggcgacgagatccacacctccatggaggccggacccgtcgtccgc
aaggccgccatgaagcagcagcgctggatcgccgcctacgaggactggaacgtcgacacc
ggcctcgcctgcggcctgcagggcaaggcccagatcggcaagggcatgtgggccatgacc
gacctcatgcgcgacatggtcgagcagaagatcggccagcccaaggccggcgccaacacc
gcctgggtgccctcacccaccggagccaccctgcacgccacccactaccacgaggtcgac
gtcttcgcggtccagaacgagctccagggcaagagccgcgccaccgtggacgacatcctc
accattcccctcgccgagaaccccaactggtccgccgaggagaagcgcgaagaactcgac
aacaactgccagtccatcctcggctacgtcgtgcgctggatcgaccagggcgtcggctgc
tccaaggtccccgacatccacgacgtcgcgctcatggaggaccgcgccaccctgcgcatc
tccagccagctcctcgccaactggatccgccacgacgtcgtcaccgccgacgacgtcgtc
gcctccctcgagcgcatggcccccgtcgtcgaccggcaaaacgaaggcgaccccggctac
cggccgctcgccccgaacttcgacgacagcatcgccttccaggccgccaaggaactcatc
ctcgaaggcaccacgcagcccagcggctacaccgagccgatcctgcaccgccgtcgccgc
gagtacaaggccaagtacgcctga

DBGET integrated database retrieval system