KEGG   Rhodococcus pyridinivorans: Y013_06890Help
Entry
Y013_06890        CDS       T02974                                 

Definition
(GenBank) glycogen synthase
  KO
K16150  glycogen synthase [EC:2.4.1.11]
Organism
rpy  Rhodococcus pyridinivorans
Pathway
rpy00500  Starch and sucrose metabolism
rpy01100  Metabolic pathways
Module
rpy_M00854  Glycogen biosynthesis, glucose-1P => glycogen/starch
Brite
KEGG Orthology (KO) [BR:rpy00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    Y013_06890
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:rpy01003]
    Y013_06890
Enzymes [BR:rpy01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.11  glycogen(starch) synthase
     Y013_06890
Glycosyltransferases [BR:rpy01003]
 Polysaccharide
  Storage polysaccharide
   Y013_06890
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glycos_transf_1 Glyco_trans_1_4 Glyco_transf_4 Glyco_transf_5 Glyco_trans_4_4 Glyco_trans_1_2 Glycogen_syn KR
Motif
Other DBs
NCBI-ProteinID: AHD20412
UniProt: V9XGH6
Position
1443883..1445130
Genome map
AA seq 415 aa AA seqDB search
MKILLVSWEYPPVVVGGLGRHVHHLATELAAAGNEVVVLSRRPTGTDASTHPTISHIADG
VLVVAVAEDAPHFDFGEDMIAWTLAMGHAMVRAGIGLTRGGIGEGWYPDVVHAHDWLVAH
PAIALAEYFDVPLVSTLHATEAGRHSGWLSGRINRQVHSVEWWLANESDRLITCSASMHD
EVTELYGPDLPEISVIRNGIDITTWSYRDREPRPGPARLLYVGRLEYEKGVQDAIAALPR
IRRSHPGTTLVVAGEGTQFEWLREQARVHRVARSVSFLGNLDHTELLGWLHGADAIVLPS
RYEPFGIIALEAAAAGTPLIASTAGGLGEAVVDGVTGLSFRPGDVAGLVSAVRETLDDPE
AARVRARAARARLTDDFDWRRVAEETAQVYSSAKRRVRHPLARPTVPQRPLPDRG
NT seq 1248 nt NT seq  +upstreamnt  +downstreamnt
atgaagattctgctcgtctcatgggagtacccacccgtcgtcgttggcggcctgggcaga
cacgtccatcatctcgccaccgaactcgccgcggcgggcaacgaggtggtggtgctgtca
cgtcgcccgaccggcaccgatgcgtcgacccaccccacgatcagccacatcgccgacggc
gtgctcgtggtggcggtcgcggaggacgcaccccacttcgacttcggcgaggacatgatc
gcctggacgctggcgatgggccacgcgatggtccgcgccgggatcgggctgacccgcggc
ggcatcggcgaaggttggtatccggacgtcgtccacgcccacgactggctcgtcgcccac
cccgcgatcgcgctggccgagtacttcgacgtgccgctcgtgtcgaccctgcacgcgacc
gaggccggtcgccacagcggttggctgtcgggccggatcaaccgccaggtgcattccgtc
gagtggtggctcgccaacgaatccgaccgtctcatcacgtgttcggcgtcgatgcacgac
gaggtcaccgagttgtacggtccggacctgccggagatctccgtgatccgcaacggcatc
gacatcaccacctggtcgtaccgcgaccgcgaaccgcgtcccgggccggcacgactgctg
tacgtcggccgcctcgaatacgagaagggtgtgcaggacgcgatcgccgcgctcccccgc
atccgccgctcgcatcccggcacgaccctcgtggtcgccggtgagggcacccagttcgag
tggctgcgcgagcaggcacgcgtacaccgcgtcgcacgctcggtgagtttcctcggcaac
ctcgaccacaccgaactgctcggctggctgcacggcgccgacgcgatcgtgctgccgagc
cgctacgagccgttcggcatcatcgccctcgaggccgccgcagcgggtaccccgctcatc
gcgtccaccgccggcggcctgggcgaagccgtggtcgacggcgtgaccggactgtcgttc
cggcccggcgacgtggccggactcgtctcggccgtccgggaaaccctcgacgatcccgag
gccgcccgagtgcgcgcgcgggcggcccgggcacgactgaccgacgacttcgactggcgc
cgcgtcgccgaggaaaccgcgcaggtctactcgtcggcgaagcggcgggtgcgtcacccg
ctcgcacgccccacggtcccccaacgtcccctcccggaccgcggatga

DBGET integrated database retrieval system