KEGG   Rhodococcus pyridinivorans: Y013_12610Help
Entry
Y013_12610        CDS       T02974                                 

Definition
(GenBank) dehydrogenase
  KO
K00004  (R,R)-butanediol dehydrogenase / meso-butanediol dehydrogenase / diacetyl reductase [EC:1.1.1.4 1.1.1.- 1.1.1.303]
Organism
rpy  Rhodococcus pyridinivorans
Pathway
rpy00650  Butanoate metabolism
Brite
KEGG Orthology (KO) [BR:rpy00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    Y013_12610
Enzymes [BR:rpy01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.4  (R,R)-butanediol dehydrogenase
     Y013_12610
    1.1.1.303  diacetyl reductase [(R)-acetoin forming]
     Y013_12610
    1.1.1.-  
     Y013_12610
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N Glu_dehyd_C ADH_N_assoc ADH_zinc_N_2 NADH_4Fe-4S Pyr_redox_3
Motif
Other DBs
NCBI-ProteinID: AHD21442
UniProt: V9XJF7
Position
complement(2715759..2716811)
Genome map
AA seq 350 aa AA seqDB search
MKAAVYYGPNKLEIADVPEPQPGPGTVKVKVGFNGICGTDLHEYYAGPIFVPTEPHPLTG
RELPLTMGHEFAGTIIEVGAGVTGYVPGDRVAIEPIYRCGRCAPCRAGTYNVCQQIGFHG
LMSDGGMAEYTIVPVNMLHRLPDNVSLELGALVEPMAVAYHAAALGDVGPGDTAIIFGAG
PIGIGLWFALRGMGLESVFVAEPSPTRRTAIEALGAHTLDPTQVDVSAFVTDVTGGRGAD
AAFDAAGVKSAIEAATASVGARRPTISVAIYEKPLTVPLLNLVMNESRIQGSLCYTSTDF
EAVIAFMAQGVYDTTGWVTTVRIDDVINEGFEALHAGRKMKVLVDPSDDM
NT seq 1053 nt NT seq  +upstreamnt  +downstreamnt
atgaaagctgctgtctactacggacccaacaaactggaaatcgctgacgttcctgaaccg
caacctggaccgggcacggtcaaggtgaaggtaggtttcaacggaatttgtggtactgac
ctgcatgaatactatgcaggcccgatcttcgtcccgaccgagccgcatccgctgaccggt
cgggaactgccgctgacgatgggccatgagttcgccgggaccatcattgaggtcggcgcg
ggcgtcaccggctatgtcccaggcgaccgagtggcgatcgagccgatctaccgatgcggg
cgctgtgcgccctgtcgggccggaacgtacaacgtgtgtcagcagatcggcttccatggc
ctgatgtccgacggcggtatggcggagtacaccatcgtgccggtcaatatgttgcatcga
ctgcccgacaacgtctcactcgaactcggtgcactggtcgagccgatggcagtcgcgtat
cacgctgcggcactcggtgacgtcgggcccggcgacacggcgataatcttcggcgccggg
cccattggtatcggactgtggttcgcgctgcgaggcatggggctcgagtcggtatttgtc
gcggaaccgtcgccgactcgccgcactgcaatcgaggcgttgggcgcccatacccttgac
ccgacccaggttgacgtgtctgcgttcgtcaccgacgtcacgggcggccgtggagcagat
gccgcatttgacgcagcgggtgtgaagtcggcaatcgaggctgcgactgcgagtgtcggt
gcacggcgaccgaccatcagcgtcgccatctacgaaaagccgttgaccgtaccgctactg
aacctggtaatgaacgaatctcggatccagggctcgctgtgctacacatccaccgacttc
gaagccgttattgcgttcatggcgcaaggtgtctacgacaccacagggtgggtcaccaca
gtcagaatcgatgatgtgatcaacgagggattcgaggcactgcatgcgggccggaagatg
aaagttcttgtcgacccctccgatgatatgtag

DBGET integrated database retrieval system