KEGG   Rhodococcus pyridinivorans: Y013_15005Help
Entry
Y013_15005        CDS       T02974                                 

Definition
(GenBank) aminotransferase AlaT
  KO
K14260  alanine-synthesizing transaminase [EC:2.6.1.66 2.6.1.2]
Organism
rpy  Rhodococcus pyridinivorans
Pathway
rpy00220  Arginine biosynthesis
rpy00250  Alanine, aspartate and glutamate metabolism
rpy00290  Valine, leucine and isoleucine biosynthesis
rpy01100  Metabolic pathways
rpy01110  Biosynthesis of secondary metabolites
rpy01130  Biosynthesis of antibiotics
rpy01210  2-Oxocarboxylic acid metabolism
rpy01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:rpy00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    Y013_15005
   00290 Valine, leucine and isoleucine biosynthesis
    Y013_15005
   00220 Arginine biosynthesis
    Y013_15005
Enzymes [BR:rpy01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.2  alanine transaminase
     Y013_15005
    2.6.1.66  valine---pyruvate transaminase
     Y013_15005
Amino acid related enzymes [BR:rpy01007]
 Aminotransferase (transaminase)
  Class I
   Y013_15005
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_1_2 DegT_DnrJ_EryC1 Aminotran_5 Beta_elim_lyase Cys_Met_Meta_PP ParD_antitoxin
Motif
Other DBs
NCBI-ProteinID: AHD21871
UniProt: V9XEJ8
Position
3215713..3216969
Genome map
AA seq 418 aa AA seqDB search
MTIEEQGQLHHHISRRLEQSSKLQNVLYEIRGPVHAHAARLEAEGHRILKLNIGNPAPFG
FEAPDTIVQDMIAALPHAQGYSESKGIASARRAIVTRYELVPRFPKFDINDVYLGNGVSE
LITITMQALLDDGDEVLIPAPDYPLWTAMTSLAGGTPVHYLCDETNDWNPDLDDIESRIT
DRTKAIVVINPNNPTGAVYSHEVLEGIVRLARKHQLLLLADEIYDKILYDDSKHVSLASL
APDLLCLTYNGLSKAYRVAGYRSGWMVITGPKDHAEGFLEGVDLLASTRLCPNVPAQHAI
QVALGGYQSIEDLVRPGGRLLEQRDVAWERLNAIPGVSCVKPRGALYAFPRLDPEVYDIH
DDEKLVQDLLLQERILVTQGTGFNWPNHDHLRIVTLPWARDLAVAIERIGNFLSSYKQ
NT seq 1257 nt NT seq  +upstreamnt  +downstreamnt
gtgactatcgaggagcaaggccaacttcaccatcacatcagccgtcggctcgagcagtcg
tcgaagctccagaacgtgctctacgagatccgcgggccggtgcacgcccacgccgcgcgg
ctcgaggccgaggggcatcgcatcctcaagctcaacatcggcaaccccgcgccgttcggg
ttcgaggcgcccgacacgatcgtgcaggacatgatcgcggcgctgccccacgcgcagggc
tactcggagtcaaagggcatcgcctccgcccgtcgcgcgatcgtcacgcgctacgagctc
gtgccgcgcttcccgaagttcgacatcaacgatgtctacctgggcaacggagtctccgag
ctcatcaccatcacaatgcaggccctgctcgacgacggcgacgaggtgctcatcccggca
cccgactatccgttgtggacggcgatgacctcgctcgccggtggcacccccgtgcactat
ctgtgcgacgagaccaacgactggaacccggacctcgacgacatcgagtcccggatcacc
gaccgcaccaaggcgatcgtggtgatcaacccgaacaacccgacgggcgccgtgtactcg
cacgaggtgctcgaggggatcgtgcgcctcgcccgcaagcaccagttgctgctgctcgcc
gacgagatctacgacaagatcctgtacgacgattcgaagcacgtctccctcgcgtcgctg
gcccccgacctgctctgcctgacctacaacggcctgtcgaaggcgtaccgggtcgccggc
taccggtcgggctggatggtcatcacgggcccgaaggatcacgcagagggcttcctcgag
ggcgtcgacctgctcgcctcgacccgcttgtgccccaatgtgccggcccagcacgccatc
caggtggcactcggcggctatcagagcatcgaggacctggtacggcccggtgggcgcctg
ctcgagcagcgcgacgtcgcgtgggagcgcctcaacgccatcccgggcgtgagctgcgtg
aagccgcgcggtgcgctctacgccttcccgcgtctggatccggaggtctacgacatccac
gacgacgagaagctcgtgcaggatctgctgctgcaggagcgcatcctcgtcacgcagggc
acgggcttcaactggccgaaccacgaccatctgcgcatcgtcacgctgccgtgggcacgc
gacctggcggtggcgatcgagcggatcggtaacttcctgtcctcctacaaacagtag

DBGET integrated database retrieval system