KEGG   Rhodococcus pyridinivorans: Y013_19150Help
Entry
Y013_19150        CDS       T02974                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
rpy  Rhodococcus pyridinivorans
Pathway
rpy00071  Fatty acid degradation
rpy00072  Synthesis and degradation of ketone bodies
rpy00280  Valine, leucine and isoleucine degradation
rpy00310  Lysine degradation
rpy00362  Benzoate degradation
rpy00380  Tryptophan metabolism
rpy00620  Pyruvate metabolism
rpy00630  Glyoxylate and dicarboxylate metabolism
rpy00640  Propanoate metabolism
rpy00650  Butanoate metabolism
rpy00900  Terpenoid backbone biosynthesis
rpy01100  Metabolic pathways
rpy01110  Biosynthesis of secondary metabolites
rpy01120  Microbial metabolism in diverse environments
rpy01130  Biosynthesis of antibiotics
rpy01200  Carbon metabolism
rpy01212  Fatty acid metabolism
rpy02020  Two-component system
Brite
KEGG Orthology (KO) [BR:rpy00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    Y013_19150
   00630 Glyoxylate and dicarboxylate metabolism
    Y013_19150
   00640 Propanoate metabolism
    Y013_19150
   00650 Butanoate metabolism
    Y013_19150
  09103 Lipid metabolism
   00071 Fatty acid degradation
    Y013_19150
   00072 Synthesis and degradation of ketone bodies
    Y013_19150
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    Y013_19150
   00310 Lysine degradation
    Y013_19150
   00380 Tryptophan metabolism
    Y013_19150
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    Y013_19150
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    Y013_19150
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    Y013_19150
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:rpy04147]
    Y013_19150
Enzymes [BR:rpy01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     Y013_19150
Exosome [BR:rpy04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Y013_19150
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt ACP_syn_III_C PIR
Motif
Other DBs
NCBI-ProteinID: AHD22592
UniProt: V9XML5
Position
4086886..4088034
Genome map
AA seq 382 aa AA seqDB search
MTEAYIVDAVRTPIGKKKGGLADVHPADLGAHVIKALVERTGIDPADVDDVVFGCVDAIG
GQAGNIARTAWLAAGYPQHVPGVTVDRQCGSSQQALHFGAQAILSDTADLIVAGGVQNMT
QIPISAAMIVGQQYGFDTPFGGSKGWTERYGSDEVSQFKGAEMIAEKWDLSREELEKWAL
QSHERAKAAIAEGRFENEIVPFDDATVDEGPRETSLEKMASLQTLVEGGRLTAAVASQIS
DGASAVLLASDEAVKKYGLKPRARIHHLSARGDDPIFMLTAPIPATQYALEKAGLTIDDI
DLIEINEAFAPVVLAWIKEIGADPSKVNVNGGAIALGHPLGATGTKLMATLLNELERTGG
RYGLLTICEGGGTANATIIERV
NT seq 1149 nt NT seq  +upstreamnt  +downstreamnt
atgaccgaggcctacatcgtcgacgcggtgcgcacccccatcggcaagaagaagggtggg
ctcgcggacgtgcacccggccgacctgggcgcgcacgtgatcaaggcgctcgtcgagcgc
acgggcatcgaccccgccgacgtcgacgacgtggtgttcggttgcgtcgacgccatcggc
ggccaggccggcaacatcgcccgcaccgcgtggctggccgccggctacccgcagcacgtg
cccggcgtgaccgtcgaccgtcagtgcgggtcgagccagcaggccctgcacttcggtgcc
caggcgatcctcagcgacaccgcggatctcatcgtcgccggtggcgtgcagaacatgacg
cagatcccgatctccgcggccatgatcgtcgggcagcagtacggcttcgacacccccttc
ggtgggtcgaagggctggacggagcgctacggcagcgacgaggtgtcgcagttcaagggt
gccgagatgatcgccgagaagtgggacctcagccgcgaggaactcgagaagtgggcgctg
cagagccacgagcgcgccaaggccgccatcgccgagggacgcttcgagaacgagatcgtc
cccttcgatgacgccaccgtcgacgaaggcccgcgcgagaccagcctcgagaagatggcg
tcgctgcagaccctcgtcgagggcggacgcctgaccgccgccgtcgccagccagatctcc
gacggcgcatccgcggtgctgctcgcctccgatgaggccgtgaagaagtacggcctgaag
ccccgcgcgcgcatccaccacctcagcgcccgcggcgacgacccgatcttcatgctcacc
gccccgatccccgccacgcagtacgccctcgagaaggccggcctgacgatcgacgacatc
gacctcatcgagatcaacgaggccttcgcgcccgtcgtcctggcgtggatcaaggagatc
ggcgccgacccgtcgaaggtcaacgtcaacggcggcgcgatcgccctcggccacccgctc
ggcgcgaccggcaccaagctgatggcgacgctgctcaacgagctcgagcgcaccggtggt
cgctacggcctgctcaccatctgcgagggtggcgggaccgccaacgcgaccatcatcgaa
cgcgtctga

DBGET integrated database retrieval system