KEGG   Rhodococcus pyridinivorans: Y013_25390Help
Entry
Y013_25390        CDS       T02974                                 

Definition
(GenBank) hypothetical protein
  KO
K14338  cytochrome P450 / NADPH-cytochrome P450 reductase [EC:1.14.14.1 1.6.2.4]
Organism
rpy  Rhodococcus pyridinivorans
Pathway
rpy00071  Fatty acid degradation
rpy00380  Tryptophan metabolism
rpy00627  Aminobenzoate degradation
rpy01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:rpy00001]
 09100 Metabolism
  09103 Lipid metabolism
   00071 Fatty acid degradation
    Y013_25390
  09105 Amino acid metabolism
   00380 Tryptophan metabolism
    Y013_25390
  09111 Xenobiotics biodegradation and metabolism
   00627 Aminobenzoate degradation
    Y013_25390
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   00199 Cytochrome P450 [BR:rpy00199]
    Y013_25390
Enzymes [BR:rpy01000]
 1. Oxidoreductases
  1.6  Acting on NADH or NADPH
   1.6.2  With a heme protein as acceptor
    1.6.2.4  NADPH---hemoprotein reductase
     Y013_25390
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.14  With reduced flavin or flavoprotein as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.14.1  unspecific monooxygenase
     Y013_25390
Cytochrome P450 [BR:rpy00199]
 Cytochrome P450, bacteria type
  CYP102 family
   Y013_25390
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NAD_binding_1 DUF5536
Motif
Other DBs
NCBI-ProteinID: AHD24278
UniProt: V9XPI1
Position
unnamed:135418..135996
Genome map
AA seq 192 aa AA seqDB search
MEGAAWSGTGRYRGTCSAYLADLTPGEIFYGHVRTPIPSFRLPADPTTPVILIGPGTGIA
PLRGFLEERAHTASTGSIELFTGCRHPKHDRLYGDELDTWHEAGRVRVHTAYSALPGHPI
RYVQHAVAAEADRIWDLLEQGAHIYICGDGLRMAPAVRQALAQIYADRTGDDGEVRLRRL
ETEGRYHQDIFA
NT seq 579 nt NT seq  +upstreamnt  +downstreamnt
gtggaaggtgccgcgtggtcgggcacgggccggtaccgaggcacgtgctctgcctacctg
gcagatctgacacccggagagatcttctacggtcatgtccgcacgcccataccgtcgttc
cgtttacccgccgatccgacgaccccggtgattctgatcggccccggaaccggtatcgca
ccgttgaggggtttcctggaagagcgcgcccacaccgcctcgacaggatcgatcgagctg
ttcaccggttgccgtcacccgaagcacgaccggctctacggcgacgaactcgacacctgg
cacgaagccggccgggtgcgggtgcacacggcctactccgcgctgcccggccatccgatc
cgttacgtccagcacgccgtggctgccgaagccgaccgcatctgggacctactcgaacaa
ggggcacatatctacatctgtggagacggactgcgcatggcaccggctgtccgacaagcg
ttggcacagatctacgccgaccggacgggcgacgacggagaagttcggctgcgccgcctc
gagaccgaagggcgctaccatcaggacatctttgcctga

DBGET integrated database retrieval system