KEGG   Rickettsia prowazekii Dachau: MA3_01185Help
Entry
MA3_01185         CDS       T01790                                 

Definition
(GenBank) phosphatidylserine decarboxylase
  KO
K01613  phosphatidylserine decarboxylase [EC:4.1.1.65]
Organism
rpz  Rickettsia prowazekii Dachau
Pathway
rpz00564  Glycerophospholipid metabolism
rpz01100  Metabolic pathways
rpz01110  Biosynthesis of secondary metabolites
Module
rpz_M00093  Phosphatidylethanolamine (PE) biosynthesis, PA => PS => PE
Brite
KEGG Orthology (KO) [BR:rpz00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    MA3_01185
Enzymes [BR:rpz01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.65  phosphatidylserine decarboxylase
     MA3_01185
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PS_Dcarbxylase
Motif
Other DBs
NCBI-ProteinID: AFE51590
Position
296871..297566
Genome map
AA seq 231 aa AA seqDB search
MKQYNDLFKIIHREGYIFIASFALVSFLLASFNEKLGCIGFIATIWCIYFFRNPDRFVPI
SDDLVISPADGIIQEIKEASPPPELGLGDLEMIRVSIFLNIFNIHVNRIPANGKILALHY
NPGKFFNASLDKASLYNERQSVLMETDQGQKIVFVQIAGLIARRIVCDLEEDNEVKMGER
YGIIRFGSRVDVYLPLKTALLVSKGQTAIGGETIIADFGRKKTEEFKFERK
NT seq 696 nt NT seq  +upstreamnt  +downstreamnt
atgaaacaatataatgatttatttaaaattattcaccgtgaaggatatatatttatcgct
agctttgcattagtaagttttttattagcatcatttaatgaaaaacttggctgtattggg
tttattgctactatttggtgtatttattttttccgtaaccctgatcgctttgtacctata
agtgatgatttagtaataagtcctgcagatggaataattcaagaaattaaggaagcctcg
ccacctccggaattagggcttggtgatctggaaatgattagagttagtattttcctaaat
atttttaatatccatgttaatagaatccccgcaaatgggaaaattttggctctgcattat
aatccaggaaagtttttcaatgcttcacttgataaagcgagtctttataatgaacgccaa
tcagtattaatggaaactgatcaaggacagaaaattgtttttgttcagatagctggactt
atagcaaggcgtatagtttgtgatttagaagaggataatgaagtaaaaatgggtgagcgg
tacggtataattcgttttggtagcagagtagatgtttatctaccgttgaaaacagcttta
ttagtgagtaaaggacaaactgctataggcggtgaaactatcattgctgattttggacgt
aaaaaaacagaagaatttaagtttgagcggaaataa

DBGET integrated database retrieval system