KEGG   Rickettsia prowazekii Dachau: MA3_02130Help
Entry
MA3_02130         CDS       T01790                                 

Gene name
sucC
Definition
(GenBank) succinyl-CoA synthetase subunit beta
  KO
K01903  succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
rpz  Rickettsia prowazekii Dachau
Pathway
rpz00020  Citrate cycle (TCA cycle)
rpz00640  Propanoate metabolism
rpz01100  Metabolic pathways
rpz01110  Biosynthesis of secondary metabolites
rpz01120  Microbial metabolism in diverse environments
rpz01130  Biosynthesis of antibiotics
rpz01200  Carbon metabolism
Module
rpz_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:rpz00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    MA3_02130 (sucC)
   00640 Propanoate metabolism
    MA3_02130 (sucC)
   00660 C5-Branched dibasic acid metabolism
    MA3_02130 (sucC)
Enzymes [BR:rpz01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     MA3_02130 (sucC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ATP-grasp_2 Ligase_CoA ATP-grasp_5 GARS_A ATP-grasp
Motif
Other DBs
NCBI-ProteinID: AFE51773
Position
complement(528411..529571)
Genome map
AA seq 386 aa AA seqDB search
MNIHEYQAKEILRKYGVPTSTGLVVTKTEKINETIDKLNTKVYVIKAQIHAGGRGKAGGV
KVAKSKEEAKKVAHDMFGINLVTHQTGPQGQKVNRIYIESGCDILKEYYFSIVFDRSASC
ITFIASTEGGVDIEAVAEKMPEKIIKFAVDPATGLQDFHMRGIAYELGFKDNQAKQMKEI
VKSVYNAFIETDATQIEINPLIINSYGNLLALDAKITFDDNGLFKHPNITAMRDHDEEDP
LETRAANAGLSYVKMDGNIGCMVNGAGLAMATMDIIKLYGALPANFLDVGGGADRERVKE
ALKIILSDKEVKGILVNIFGGIMRCDIIAEGIIAAAKDIGIKVPLVVRLAGTNVEKGKEI
LSNSDLKIIPAHDLADAANKIVEAIR
NT seq 1161 nt NT seq  +upstreamnt  +downstreamnt
atgaatattcatgaatatcaagcaaaagagattttaagaaaatacggcgtgcctacgtcc
actgggctagtcgttactaaaactgaaaagattaatgaaaccatagataaattaaatacg
aaagtatatgtgattaaagcacaaatacatgcaggaggtagaggtaaagcaggcggagtt
aaggtcgcaaaaagtaaagaagaagccaaaaaagtggctcatgatatgtttggtattaat
ttagtaacgcatcaaacaggccctcaaggacagaaagtaaatcgtatttatatcgaatca
ggatgtgatattttaaaagaatattattttagtatagtatttgatagatcagcgagctgt
attacttttatagcgtctaccgaaggtggtgttgatattgaagcagtagcagaaaaaatg
ccggaaaaaattattaaatttgcagttgatcctgcaactggtttacaagattttcatatg
agaggcatagcgtatgagttaggattcaaggataatcaagctaaacagatgaaagaaata
gtaaaatcagtctataacgcttttattgaaactgatgcaacacaaattgaaattaacccg
ttaattataaatagctatgggaacttattagcattagatgcaaaaatcacttttgatgat
aatggcttatttaaacatccaaatattactgcaatgcgtgatcatgatgaagaagatcca
ttagaaactcgagcagcgaacgcagggcttagttatgtaaaaatggacggtaatattggt
tgtatggttaatggtgctggtcttgcaatggctactatggatattattaaactttacggt
gctttacctgcaaattttttagatgtaggtggcggagcagaccgtgagcgtgtgaaagaa
gcacttaaaataattctatcagataaagaagtaaaaggaattttagtgaatatttttgga
ggtattatgcgttgtgatattatagcagaaggaattattgcggctgcaaaagacataggt
ataaaagtaccattggtagtccgcttagcaggtacaaacgttgaaaaaggcaaagaaatt
ttatcaaattccgatttaaaaataataccagcacatgatttagcagatgcggcaaataag
atagttgaggctatacgataa

DBGET integrated database retrieval system