KEGG   Rickettsia prowazekii Dachau: MA3_03185Help
Entry
MA3_03185         CDS       T01790                                 

Gene name
rplV
Definition
(GenBank) 50S ribosomal protein L22
  KO
K02890  large subunit ribosomal protein L22
Organism
rpz  Rickettsia prowazekii Dachau
Pathway
rpz03010  Ribosome
Brite
KEGG Orthology (KO) [BR:rpz00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    MA3_03185 (rplV)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:rpz03011]
    MA3_03185 (rplV)
Ribosome [BR:rpz03011]
 Ribosomal proteins
  Mitochondria/ Chloroplast
   Large subunit
    MA3_03185 (rplV)
  Bacteria
    MA3_03185 (rplV)
  Archaea
    MA3_03185 (rplV)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ribosomal_L22
Motif
Other DBs
NCBI-ProteinID: AFE51980
Position
complement(814800..815159)
Genome map
AA seq 119 aa AA seqDB search
MIQKNKNFATAKAKSIRVSPRKLNLVASFIRNMKVSEALVQLTFSPKRIAKIVKDCLQSA
IANAENNLGLDIDRLIITKATVGKSVVMKRIMPRAKGRATRINKFFSNLYITVTEKEDN
NT seq 360 nt NT seq  +upstreamnt  +downstreamnt
atgatacagaaaaataaaaattttgctacggcaaaagctaaatctattagagtaagccca
aggaaacttaatttagttgcgtcctttattagaaatatgaaagtatctgaagcattagta
caattaactttttctcctaaaagaattgcaaaaattgtaaaagattgtctacaatctgct
attgcaaatgctgaaaataatttaggtttagacatagatagattaattattactaaagct
actgtaggtaagtcagtagtaatgaaaaggattatgccaagagcaaaaggcagagcaact
agaataaataagttttttagtaatctttatataactgttacagaaaaagaggataattaa

DBGET integrated database retrieval system