KEGG   Rhodococcus qingshengii: C1M55_04725Help
Entry
C1M55_04725       CDS       T05315                                 

Definition
(GenBank) N-acetylglucosamine-6-phosphate deacetylase
  KO
K01443  N-acetylglucosamine-6-phosphate deacetylase [EC:3.5.1.25]
Organism
rqi  Rhodococcus qingshengii
Pathway
rqi00520  Amino sugar and nucleotide sugar metabolism
rqi01100  Metabolic pathways
rqi01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:rqi00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    C1M55_04725
Enzymes [BR:rqi01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.25  N-acetylglucosamine-6-phosphate deacetylase
     C1M55_04725
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Amidohydro_1 Amidohydro_3 TPP_enzyme_C
Motif
Other DBs
NCBI-ProteinID: AUS30485
UniProt: A0A5C1JBD8
Position
1:1009204..1010388
Genome map
AA seq 394 aa AA seqDB search
MMHRGQILRGQLVTGGQLLPDGVVEISGDRVVWAGPASQRTDPLPERAAAGTTIIPGLVD
VHCHGAGGFGFPEADEFGSTVAADHHRTNGTTSVIGSLVSAPPQILRSRIELLAGLVDEG
TLAGIHLEGPFLSVLRCGAQDPDSILDGDPALLESLLEAGRGHIRSMTIAPETAHFGELA
SLLERHRAVVSIGHTDASNPIATRSIAHSAHAPLSATHLFNGMAPMHHRAPGAVAACLAA
AAKGQMVVELIGDGVHLADETVATVFDLVGPHQIALVSDAMAAAGMPDGRYPLGPLDVDV
IDGVARLAGQGETAIAGGTSRLMDIVRRAVNHAGVDLLSAVIAATATPASLMGLAGMVGD
LVPGCRADLIVTGPELETRAVMAAGNWLMNYTES
NT seq 1185 nt NT seq  +upstreamnt  +downstreamnt
gtgatgcatcgtggacaaattcttcgtggacaactggtgaccggtgggcaactgcttccg
gacggtgtcgtcgagatttccggtgatcgtgtggtgtgggccgggcccgcgtcgcagcga
accgacccgttacccgaacgggcagctgcggggacaacgatcatcccggggttggtggac
gttcactgccacggcgccggcggattcggtttccccgaggcagacgagttcggatccacc
gtggctgccgatcaccaccggacgaacggcacgacctcggtgatcggctcgctcgtctcc
gcgccgccgcagatcctgcgcagtcgcatcgagctcctggcaggactggtggacgagggc
acgctggccggaattcacctggaaggtccattcctgtcggtactccgttgtggcgcccag
gatcccgacagcattctcgacggcgacccggctctgctcgagtcgctgctcgaagccggc
cgcgggcacatccgctcgatgacgatcgctccggagacagcacacttcggcgaacttgcc
tcattgctggagcgtcaccgggccgtcgtgagtatcggacacaccgatgcgtccaacccg
attgcgacacgttcgatcgcacactcggcgcatgcaccgctcagtgccactcacctgttc
aacggtatggctccgatgcatcatcgcgctcccggcgcagtggcggcgtgtcttgccgcg
gccgcgaaaggacagatggtggtcgagttgatcggggacggagtacatctcgccgacgag
acggtggcgacggtgttcgatctggtcggtccgcatcagatcgcgttggtctccgacgcg
atggctgccgccggaatgcccgacggccgttacccactcgggcctctcgacgtcgacgtg
atcgatggcgtggcgcgattggccggccagggggaaacggccattgccggcgggacgagt
cggttgatggacatagtccgccgggctgttaatcacgccggcgtcgatctgctttcggct
gtcatcgcagcgacggcaacgcctgcttcgctgatggggctggccggaatggtcggcgat
ctcgtgccgggttgccgcgccgatctgatcgtcaccggtccagaactcgaaacccgcgcc
gtcatggccgctgggaactggctcatgaactacaccgaaagctga

DBGET integrated database retrieval system