KEGG   Rhodococcus qingshengii: C1M55_08415Help
Entry
C1M55_08415       CDS       T05315                                 

Definition
(GenBank) acyl-CoA oxidase
  KO
K00232  acyl-CoA oxidase [EC:1.3.3.6]
Organism
rqi  Rhodococcus qingshengii
Pathway
rqi00071  Fatty acid degradation
rqi00592  alpha-Linolenic acid metabolism
rqi01040  Biosynthesis of unsaturated fatty acids
rqi01100  Metabolic pathways
rqi01110  Biosynthesis of secondary metabolites
rqi01212  Fatty acid metabolism
Module
rqi_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:rqi00001]
 09100 Metabolism
  09103 Lipid metabolism
   00071 Fatty acid degradation
    C1M55_08415
   00592 alpha-Linolenic acid metabolism
    C1M55_08415
   01040 Biosynthesis of unsaturated fatty acids
    C1M55_08415
Enzymes [BR:rqi01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.3  With oxygen as acceptor
    1.3.3.6  acyl-CoA oxidase
     C1M55_08415
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ACOX Acyl-CoA_dh_M Acyl-CoA_dh_1 Acyl-CoA_dh_N Acyl-CoA_dh_2
Motif
Other DBs
NCBI-ProteinID: AUS35219
UniProt: A0A069JAH7
Position
1:complement(1791643..1793574)
Genome map
AA seq 643 aa AA seqDB search
MATTADHLRTTLDGRWREVRERVRGELNDERFAPHYTPNTAIARSKALEQMRVLADLGYA
ANGFAVSHGGTGDAGGAVTSIEMLAMSDLSLMVKAGVQWGLFGGAIENLGTERHHQAYVK
PLIDLDLLGCFAMTETGHGSDVQELETTATYDVETGEFVVNSPTPSSRKDYIGGAAQHAT
VAAVFAQLITGGESQGVHCFVVPIRDDAGNDLPGVTTSDCGLKGGLPGVDNGRIVFDQVR
IPRENLLNRYADVAEDGTYSSAIENPNRRFFTMVGTLVRGRVTVGGSAAAAARVGLAIAG
RYALQRRQFSAPKSDDEVLIMDYLVHQKRLLPLIARSYALQFAQNELVAAMHDIQSSDDP
DPQEQRELEGRAAGLKAANTWHATRAIQEAREACGGAGYLAENRLTALKADTDVFTTFEG
DNHVLTQLVAKELLTSYADEVRGMSPVDWMRFAATTVSDVVKKRTAAQQILQTIVDTRQD
NEEDGSLFNRGTQMKMFEDREEYLLATAARRLQAAQKREENPFDAFNFVQDHVLKAAQAH
IERVILEAFVAGIDSCEDETAKELFGEVCDLYALSVIEEDKAWFMEHRHLSVERSKAVTR
GINERCRTLRPHVETLIDGFGIPDILLGSAMLDGPGTDAVRLK
NT seq 1932 nt NT seq  +upstreamnt  +downstreamnt
atggccaccacagcggaccacctcaggacaacactcgacggacgctggcgggaggtgcgt
gagcgcgttcgcggcgaattgaacgacgaacgttttgctccgcactacacacccaacacc
gccattgcgcgctccaaggctctcgaacagatgcgggtcctcgccgatctcgggtacgcc
gcaaacggtttcgccgtctctcacggcggaacgggcgacgcgggtggcgccgtcaccagc
atcgagatgctcgcgatgtccgacctctccctgatggtcaaggccggcgtccagtggggt
ctgttcggcggcgccatcgaaaacctcggcaccgagcgtcaccaccaggcgtacgtcaag
ccgctgatcgatctggacctgctcggttgctttgcgatgaccgagaccggtcacggcagc
gacgtccaggaactcgaaaccacggcgacctacgacgtcgagacgggcgagttcgtcgtc
aactcccccactccgtcctctcgcaaggactacatcggcggcgctgcccagcacgccacc
gtcgcagcggtgttcgcgcagctgatcaccggaggcgaaagtcagggcgtccactgcttt
gtcgtgccgattcgtgacgacgccggcaacgacctccccggcgtcacgacgtccgactgc
gggctcaagggtggactgcccggagtcgacaacggccgcatcgtcttcgaccaggtccgc
atcccgcgtgagaatctactcaatcgttacgccgacgtcgccgaggacggcacgtacagt
tcggcgatcgagaacccgaaccgtcgtttcttcacgatggtcggcacactggttcgtgga
cgtgtcaccgtcggtggttccgcggcagcggccgcccgcgtcggattggccatcgccggt
cgatacgccctgcagcgcaggcagttcagtgctccgaagagtgacgacgaagtcctgatc
atggactacctcgtccaccagaagcgtctgctgccgttgatcgcccgctcgtacgctctg
cagttcgcacagaacgaactcgtcgccgcgatgcacgacatccagagcagcgacgacccg
gatccgcaggagcagcgcgaactcgaaggtcgcgccgccggactcaaggccgccaacacc
tggcatgccactcgggccatccaggaagcacgcgaagcctgcggcggcgcaggctatctc
gccgagaaccgcctcaccgcactcaaggcggacaccgacgtcttcaccacgttcgagggt
gacaaccacgttctgacgcagttggtcgcaaaagaactcctcacctcctacgccgacgaa
gtccgcggcatgagcccggtcgactggatgcgcttcgccgctacgacggtctccgacgtg
gtcaagaaacgcacggcagcgcagcagatcctgcagacgatcgtcgacactcgccaggac
aacgaagaggacggcagcctcttcaatcgcggcacccagatgaagatgttcgaagaccgc
gaagagtacctactcgccactgcggcaaggcgattgcaggcagcgcagaagcgcgaggag
aacccgttcgacgcgttcaacttcgtgcaggaccacgtactcaaagccgctcaggcgcac
atcgagcgcgtcatcctggaagcattcgtcgccggcatcgactcgtgtgaggacgagacc
gcgaaggaactcttcggcgaggtgtgcgatctctacgcactgtccgtgatcgaagaggac
aaggcctggttcatggagcaccggcatctgtcggtggagcgttcgaaggccgtgacgcgc
ggaatcaacgagcgttgccgcaccctgcgcccccacgtcgagacactgatcgacgggttc
ggcattccggacatcctgctggggtccgcgatgctcgacggaccgggcaccgacgcggta
cggctgaagtaa

DBGET integrated database retrieval system