KEGG   Rhodococcus qingshengii: C1M55_29780Help
Entry
C1M55_29780       CDS       T05315                                 

Definition
(GenBank) aldehyde dehydrogenase
  KO
K00148  glutathione-independent formaldehyde dehydrogenase [EC:1.2.1.46]
Organism
rqi  Rhodococcus qingshengii
Pathway
rqi00625  Chloroalkane and chloroalkene degradation
rqi00680  Methane metabolism
rqi01100  Metabolic pathways
rqi01120  Microbial metabolism in diverse environments
rqi01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:rqi00001]
 09100 Metabolism
  09102 Energy metabolism
   00680 Methane metabolism
    C1M55_29780
  09111 Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    C1M55_29780
Enzymes [BR:rqi01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.46  formaldehyde dehydrogenase
     C1M55_29780
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N ADH_N_assoc Glu_dehyd_C FAD_oxidored AlaDh_PNT_C HI0933_like FAD_binding_3 Pyr_redox_2 Rep_1B Shikimate_DH
Motif
Other DBs
NCBI-ProteinID: AUS35630
UniProt: A0A1X0LR98
Position
1:6299391..6300530
Genome map
AA seq 379 aa AA seqDB search
MKALVYDGPREVHVKDVPDARIENPTDVLVKITSTNICGSDLHMYEGRTDLEPGMVLGHE
NLGIVAEVGNAVVKVSPGDRVCLPFNIGCGFCRNCEEGLTAFCLTVHPDPKMAGAAFGFA
GMGPFWGGQAEYLRVPFGDFNCLRLPEDAQDKETDYVMLSDIFPTGWHCTRLADMQPGDS
MVVYGAGPVGLMAAYSAMIQGASKVMIVDRHPDRLRLAEEIGVVPIDDSKGDPVEQVLEQ
TNGKGADKGCECVGYQAHDPQGHEDAAMTMNRLVDSVRFTGHIGVVGIFLPQDQNGPDEL
ERNGKIAFDMGKFWFKGQKIGTGQANVKHYNRQLRDLIHEDRAKPSWIISHELPLAEAES
GYQHFDARDDGWTKVVLHP
NT seq 1140 nt NT seq  +upstreamnt  +downstreamnt
atgaaagcgcttgtatacgacgggcctcgagaggtccacgtcaaggacgtgcccgatgcg
cggatcgagaatccgacagatgtgctggtgaagatcacgagcaccaacatctgcgggtcg
gatctacacatgtacgaaggccgcaccgatctggagcccggaatggtcctcggtcacgaa
aacttgggcatcgtcgccgaagtcggcaatgcagtggtcaaagtatcgccaggggatcga
gtgtgcttgccgttcaacatcggctgcggcttctgccgaaactgcgaggaagggttgact
gcattctgcctgacggtgcaccccgatccgaagatggccggcgctgcattcggtttcgcg
gggatgggcccgttctggggcggacaggcggaatatctgcgagtgccgttcggcgacttc
aactgtctgcgactgcccgaggatgcccaggacaaggaaaccgactacgtgatgctgtcg
gacatctttcccaccggatggcattgcacccgcctggccgacatgcaacccggcgattcg
atggtggtctacggcgctggcccagtcggtttgatggccgcgtattcggcgatgatccag
ggagcgagcaaggtgatgatcgtcgaccgccaccccgaccggctacgcctggccgaagag
atcggcgtcgtccccatcgacgactcgaagggcgaccccgtcgagcaggtcctcgagcaa
accaacgggaaaggcgcagacaaggggtgcgagtgcgtcggctatcaggcacacgacccg
caaggccacgaggacgccgccatgacgatgaaccggctcgtggattcggtgcgcttcacc
ggccacatcggggtggtcggcatcttccttccccaggaccagaacggccccgacgaactc
gagcgcaacggcaagatcgccttcgacatgggcaaattctggttcaagggccagaagatc
ggcaccggacaagcgaacgtcaaacactacaaccggcaactgcgcgacctcatccacgaa
gaccgggcaaagccctcctggatcatctcccacgaactcccgctcgccgaagccgaatcc
ggctaccagcacttcgacgctcgcgacgacggctggaccaaagtcgtcctgcatccctga

DBGET integrated database retrieval system