KEGG   Rickettsia rickettsii Brazil: RPN_03020Help
Entry
RPN_03020         CDS       T01737                                 

Definition
(GenBank) branched-chain alpha-keto acid dehydrogenase subunit E2
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
rrb  Rickettsia rickettsii Brazil
Pathway
rrb00010  Glycolysis / Gluconeogenesis
rrb00020  Citrate cycle (TCA cycle)
rrb00620  Pyruvate metabolism
rrb01100  Metabolic pathways
rrb01110  Biosynthesis of secondary metabolites
rrb01120  Microbial metabolism in diverse environments
rrb01130  Biosynthesis of antibiotics
rrb01200  Carbon metabolism
Module
rrb_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:rrb00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    RPN_03020
   00020 Citrate cycle (TCA cycle)
    RPN_03020
   00620 Pyruvate metabolism
    RPN_03020
Enzymes [BR:rrb01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     RPN_03020
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2 CAT QRPTase_N
Motif
Other DBs
NCBI-ProteinID: AFB22126
Position
complement(490560..491798)
Genome map
AA seq 412 aa AA seqDB search
MPIKILMPALSPTMTEGNLARWLKKEGDKVNPGEVIAEIETDKATMEVEAVDEGILAKIV
IPQNSQNVPVNSLIAVLSEEGEEKTDIDAFIAKNNSVSPSPKTDANLLKPHENITNVEEQ
VTVIKHDASKIFASPLAKRLAKMRNIRFESVKGSGPHGRIVKQDILSYTPSTAHNKIVSR
NPEEYRLVPNNNIRKIIAKRLLESKQTVPHFYLSIECNVDKLLDIREDINKSFSEDKSTR
ISVNDFIILAVAKALQEVPNANASWGEDAIRYYNNVDISVAVAIENGLVTPIVKNANQKN
ILELSREMKALIKKAKDNKLTPEEFQGGGFTISNLGMYGIKNFNAIINPPQSCIMGVGAI
AKRAIVKNDQITIATIMDVTLSADHRVVDGAVGAEFLAAFKKFIESPVLMLI
NT seq 1239 nt NT seq  +upstreamnt  +downstreamnt
atgccgattaaaattttaatgcctgctttatctccaactatgacggaaggaaatctagct
aggtggttaaaaaaagaaggggacaaagttaatcctggagaagtaattgctgaaattgaa
accgataaagcaacgatggaagtagaagcagtagacgaaggtatacttgccaaaatagtt
atcccacaaaatagtcaaaatgtacctgttaactctttaattgccgtgttaagtgaagag
ggagaagaaaaaacagacattgatgcgtttattgcaaaaaataatagtgtatcaccgtca
ccgaaaacagatgctaatcttctgaaaccccacgagaatataactaatgtagaagaacag
gtaacagttataaaacatgatgctagtaaaatattcgcctcaccgcttgcaaaaagactt
gcaaaaatgagaaatattagatttgagagcgtgaaaggtagcggtccgcacggtagaata
gtcaaacaagatatcttatcatatactcctagcactgctcataataaaatagttagcaga
aatcctgaagaatatcgtttagtaccaaataataatatccgcaagattatagccaagcgt
ctgcttgaatctaaacaaacagttccacatttttatttatctatagaatgtaatgtcgat
aaattgttagatataagagaagacattaataaatctttttctgaagataaatcaacaagg
atatcggttaatgattttattattttagcagtagccaaagctttacaagaagtgccaaat
gccaatgctagctggggagaagatgcaattagatattacaataatgtcgatatttcagta
gcggtagcgattgagaacgggcttgttacaccgatagttaaaaatgccaatcaaaaaaac
attctagaactatctcgtgaaatgaaagcattaataaagaaagcaaaagataataaatta
acccctgaagaatttcagggtggagggtttaccatttctaacctcggtatgtacggtatt
aagaatttcaatgctataattaacccaccgcaaagttgtataatgggcgtcggagctatt
gcaaaacgtgctatagtcaagaatgatcaaataactatagcaacaattatggacgtaact
ctttctgccgatcaccgagtagtagacggagcagtcggtgctgagttcttggcagcattt
aaaaagtttatagagagtcccgttttgatgttgatataa

DBGET integrated database retrieval system