KEGG   Rickettsia rickettsii Brazil: RPN_04940Help
Entry
RPN_04940         CDS       T01737                                 

Definition
(GenBank) pyruvate dehydrogenase e1 component, alpha subunit precursor
  KO
K00161  pyruvate dehydrogenase E1 component alpha subunit [EC:1.2.4.1]
Organism
rrb  Rickettsia rickettsii Brazil
Pathway
rrb00010  Glycolysis / Gluconeogenesis
rrb00020  Citrate cycle (TCA cycle)
rrb00620  Pyruvate metabolism
rrb01100  Metabolic pathways
rrb01110  Biosynthesis of secondary metabolites
rrb01120  Microbial metabolism in diverse environments
rrb01130  Biosynthesis of antibiotics
rrb01200  Carbon metabolism
Module
rrb_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:rrb00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    RPN_04940
   00020 Citrate cycle (TCA cycle)
    RPN_04940
   00620 Pyruvate metabolism
    RPN_04940
Enzymes [BR:rrb01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.4  With a disulfide as acceptor
    1.2.4.1  pyruvate dehydrogenase (acetyl-transferring)
     RPN_04940
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: E1_dh DXP_synthase_N TPP_enzyme_C Transketolase_N
Motif
Other DBs
NCBI-ProteinID: AFB22474
Position
complement(815009..815989)
Genome map
AA seq 326 aa AA seqDB search
MDIKLGKYKPTKEEYIKSFKDMLLLRRFEEKCGQLYGMGEIGGFCHLYIGQEAVISAVDM
VKQKGDSTITSYRDHAHIILAGTEPKYVLAELMGRATGCSKGKGGSMHLFNVPHKFYGGH
GIVGAQVPIGTGLAFAEKYNDTHNICFTFLGDGAVNQGQVYEAFNMAALWGLPVVYIIEN
NEYSMGTSVARSTFMRDLYKKGASFGIKGFQLDGMDFKEMYDGSKQAAEYVRENSFPLIL
EVKTYRYRGHSMSDPAKYRSKEEVEQYKERDPLVIIRKTILDNKYVTEADLKAIEQSVKE
IVKEAVEFSENSPLPDEGELYTQVYC
NT seq 981 nt NT seq  +upstreamnt  +downstreamnt
gtggatattaagttaggaaaatataagccgacaaaggaagaatatataaaaagctttaaa
gatatgctcctactgcgtcgttttgaagaaaaatgcggtcagttatacggaatgggagaa
atcggtggtttttgtcatttatatatagggcaagaagcagtaatttctgcagtagatatg
gttaaacaaaaaggtgatagcactattactagctatcgtgaccatgctcatattatttta
gcaggaactgagcctaagtatgttcttgccgagcttatggggcgtgctacaggttgctcg
aaaggtaagggtggctcgatgcatttatttaatgtaccccacaaattttacggtggacac
ggtatagtaggggctcaagtaccgataggtacagggcttgcgtttgctgaaaaatataac
gatacgcataatatctgttttacttttttaggtgacggtgccgttaatcaaggtcaggta
tatgaagcttttaatatggctgctttatggggtttgccggtagtttatattattgaaaat
aacgaatattcgatggggacgtctgtagcacgttctacctttatgcgtgatttatataag
aaaggggcatcgtttgggattaaaggatttcagctagacggtatggattttaaagaaatg
tatgacggctctaagcaagcagccgagtatgttagagaaaatagctttcctctgatatta
gaggtaaaaacttatcgttatcgtgggcattcgatgtccgacccggcaaaatatcgtagt
aaagaagaagttgagcaatataaagagcgtgatccgttggtaataataagaaaaacgata
ctcgacaataaatatgtaaccgaagcggatttaaaagcaatagaacagtcggtaaaagaa
attgtgaaagaagcagtagaattctcagaaaattcaccgctacctgatgaaggggagttg
tatacacaggtgtactgttaa

DBGET integrated database retrieval system