KEGG   Rickettsia rickettsii Colombia: RPL_02515Help
Entry
RPL_02515         CDS       T01722                                 

Definition
(GenBank) glutamyl-tRNA synthetase
  KO
K01885  glutamyl-tRNA synthetase [EC:6.1.1.17]
Organism
rrc  Rickettsia rickettsii Colombia
Pathway
rrc00860  Porphyrin and chlorophyll metabolism
rrc00970  Aminoacyl-tRNA biosynthesis
rrc01100  Metabolic pathways
rrc01110  Biosynthesis of secondary metabolites
rrc01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:rrc00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    RPL_02515
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    RPL_02515
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:rrc01007]
    RPL_02515
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:rrc03016]
    RPL_02515
  09183 Protein families: signaling and cellular processes
   02048 Prokaryotic defense system [BR:rrc02048]
    RPL_02515
Enzymes [BR:rrc01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.17  glutamate---tRNA ligase
     RPL_02515
Amino acid related enzymes [BR:rrc01007]
 Aminoacyl-tRNA synthetase
  Class I (A)
   RPL_02515
Transfer RNA biogenesis [BR:rrc03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    RPL_02515
 Prokaryotic type
   Other AARSs
    RPL_02515
Prokaryotic defense system [BR:rrc02048]
 Toxin-antitoxin system (TA system)
  Type II TA system
   Type II TA system related factors
    RPL_02515
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: tRNA-synt_1c DUF4105
Motif
Other DBs
NCBI-ProteinID: AFB23392
Position
complement(444487..445830)
Genome map
AA seq 447 aa AA seqDB search
MTKVITRFAPSPTGMLHVGNIRAALLNWLYAKKHNGQFILRFDDTDLERSKQEYKDAIEE
DLKFLNINWDQTFNQLSRLSRYDAIKNLLLDKKRLYACYETPEELELKRKFQLSKGLPPI
YDRASLNLTEEQAKKYIEQGRKPHYRFLVNHEPISWHDMIKGEVKYDGKALSDPIVIRAD
GSMTYMLCSVIDDIDYDITHIIRGEDHVSNTAIQMQMFEALNTTPPTFGHLSLIINKDEK
ISKRVGGFEIATLRKEIGIEAMAIASFFSLLGSSAQILPYKSMEKLANQFEISSFSKSPT
IYQPEDLERLNHKLLISLDFDTVKERLKEIDAEYIDENFWLSVSPNLQKLRDVKDWWEIC
HQTPNVENLNLDKEYLKQAAELLPKGEITKDSWSIWTKEITNITGRKGKELFLPLRLALT
ARESGPEIASVLPLIDREEIIKRLTSA
NT seq 1344 nt NT seq  +upstreamnt  +downstreamnt
atgacaaaagttataacacgatttgctccgtcaccgaccggtatgttacatgtcgggaat
atcagggcagcattgcttaactggctatatgcaaagaagcataacggacagtttatttta
agatttgacgatacggatttagagcgtagtaaacaggaatataaagacgctatcgaggaa
gatctaaaatttttaaatattaattgggatcagacatttaatcaattaagtcgtttaagt
agatatgatgcaatcaaaaatctattactagacaaaaaaagattatatgcctgctatgag
actcctgaagagctagaattaaagcgtaaatttcaattatctaaaggtttaccaccgatt
tatgatcgagctagcttaaatctcactgaagagcaagcaaagaaatatatagaacaagga
agaaaaccgcattatagatttttggtaaatcatgaaccgattagctggcatgatatgatc
aaaggcgaagttaaatatgacggcaaggctttaagcgacccaatagtgataagagcagac
ggtagtatgacctatatgttatgctcagttattgatgatattgattatgatattactcat
attattaggggtgaagatcacgttagcaataccgccattcaaatgcaaatgtttgaggct
ttaaatactactcctccgacttttgggcatttaagtttaataatcaataaagatgagaaa
atttctaaaagagttggagggtttgagatcgcaactcttagaaaagaaatcggaatcgaa
gctatggcaatcgctagcttttttagtttacttggttcatcagcacaaatcttgccttat
aaatcaatggagaagctagcaaatcaatttgagataagtagtttctctaaaagtccaact
atctatcagccggaagatttagaaagattaaatcataaattacttataagtttagatttt
gatacagtaaaagaacgccttaaagaaatagatgccgagtatattgatgaaaatttttgg
ttatcggtaagccctaacttgcaaaaattacgtgatgtaaaagattggtgggaaatttgc
catcaaactccgaatgtagaaaatctaaatttagataaggaatatttaaagcaagcagca
gaattattaccgaaaggtgaaatcactaaagatagctggagcatttggactaaagaaata
acaaatataacaggcaggaaaggtaaggagttatttttacctcttcgccttgctttaacc
gccagagaatcaggaccagaaatcgcaagcgttttacctttgattgatagagaagagata
ataaagcgtttaactagtgcgtga

DBGET integrated database retrieval system