KEGG   Rickettsia rickettsii Colombia: RPL_03120Help
Entry
RPL_03120         CDS       T01722                                 

Gene name
lspA
Definition
(GenBank) lipoprotein signal peptidase
  KO
K03101  signal peptidase II [EC:3.4.23.36]
Organism
rrc  Rickettsia rickettsii Colombia
Pathway
rrc03060  Protein export
Brite
KEGG Orthology (KO) [BR:rrc00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03060 Protein export
    RPL_03120 (lspA)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:rrc01002]
    RPL_03120 (lspA)
Enzymes [BR:rrc01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.23  Aspartic endopeptidases
    3.4.23.36  signal peptidase II
     RPL_03120 (lspA)
Peptidases and inhibitors [BR:rrc01002]
 Aspartic peptidases
  Family A8: signal peptidase II family
   RPL_03120 (lspA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_A8 Saf_2TM
Motif
Other DBs
NCBI-ProteinID: AFB23508
Position
554627..555166
Genome map
AA seq 179 aa AA seqDB search
MIIDQLSKWWFINNLRWKPGLMLKVTSFLNMVYTWNYGISFGLMREYYQYSNAIFLITNT
IIVCYLYYLMIRSKTIGSFAGYSFVIGGAVGNLIDRFFRGAVFDFIHFHYQNYSFPVFNL
ADCFITIGVIILIEDYYSTKKVIEEKAKGNYDNAQIEAMAEKIRNTDKGGNDKIASLQN
NT seq 540 nt NT seq  +upstreamnt  +downstreamnt
gtgattattgatcagttaagtaaatggtggtttattaataatttgagatggaagccgggc
ttaatgcttaaggttacttctttcttaaatatggtttatacttggaattacggtattagc
tttggtctaatgcgtgaatattatcaatatagcaatgctattttcttaataacgaatacg
attattgtctgttatttatattatttgatgatacgttcaaaaacgatcggaagctttgcc
ggttatagctttgtaatcggcggagctgttggtaatctaattgatagattttttagagga
gcagtttttgacttcatccattttcattatcagaattatagcttccccgtatttaattta
gctgattgctttattacaataggagtaattatcttaatagaagattattatagtactaaa
aaagttattgaagaaaaggctaaagggaattatgataatgctcaaattgaagctatggct
gaaaaaattcgtaataccgataagggtggtaatgataaaatagcttccttgcaaaattaa

DBGET integrated database retrieval system