KEGG   Rickettsia rickettsii Colombia: RPL_04450Help
Entry
RPL_04450         CDS       T01722                                 

Definition
(GenBank) delta-aminolevulinic acid dehydratase
  KO
K01698  porphobilinogen synthase [EC:4.2.1.24]
Organism
rrc  Rickettsia rickettsii Colombia
Pathway
rrc00860  Porphyrin and chlorophyll metabolism
rrc01100  Metabolic pathways
rrc01110  Biosynthesis of secondary metabolites
rrc01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:rrc00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    RPL_04450
Enzymes [BR:rrc01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.24  porphobilinogen synthase
     RPL_04450
Exosome [BR:rrc04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   RPL_04450
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ALAD UxuA AP_endonuc_2
Motif
Other DBs
NCBI-ProteinID: AFB23742
Position
complement(758433..759449)
Genome map
AA seq 338 aa AA seqDB search
MYPHIRLRRNRKAFWLRELISESNLSVSDLVLPLFVVEGHNERQEIKTMPGIYRLSIDQI
VETAKEAAELGINVIALFPSIDQSLKSDNADEAYNLDNLICRTIRSIKNANIDIGIICDV
ALDPYTTHGHDGIVHHGAVDNDRSVSALCNQALVLAKAGVDIVAPSDMMDGRIRAIREYL
DKEGFINVGILAYAAKYASSFYGPFRDAVKSNKKNYLDKSSYQMDVRNIKEAMLEIEHDI
AEGADMVMVKPGMPFLDVIREAANNLNAKIFAYQVSGEYAMLKFAAEAGAMDWERALMES
LISFKRAGATGIFTYAALEVAEILKNNKIRYKMASDIK
NT seq 1017 nt NT seq  +upstreamnt  +downstreamnt
atgtacccccatattagacttagaagaaatagaaaagctttttggcttagagagttaata
tccgaaagtaatttatcggttagtgatttagtgttgcctttatttgttgttgaaggacat
aatgaaaggcaagaaattaaaactatgcctggtatatatcgtttatcgattgatcaaata
gtagaaacggcaaaagaagcagcagagctgggtattaatgttattgcattatttccgagt
attgatcaaagtctaaaaagcgacaatgccgatgaggcttataatttagataatttaata
tgtagaactattagaagcatcaaaaacgctaatatcgatattggtataatatgcgatgta
gcacttgatccttatactacacatggtcatgatggtattgtgcatcatggggcagttgat
aatgatagatcagtaagcgctttgtgtaatcaggcattagtgctagcaaaagctggagta
gatattgttgcaccttccgatatgatggatggaagaatcagggctataagggaatatctt
gacaaagagggatttataaatgttggaattcttgcttatgccgctaaatatgcttcaagt
ttttatggtccgtttcgcgatgctgttaagagtaataaaaagaattatttagataaatca
agctatcaaatggatgtacgtaatattaaggaagcaatgcttgagattgagcatgatata
gcagagggagccgatatggtaatggtgaagcctggtatgccgtttttggatgttattcgt
gaagcggcaaataatttaaatgctaaaatttttgcatatcaggttagtggagaatatgca
atgttaaaatttgcagcagaagcaggggcaatggattgggagagagctttgatggagtca
ttaattagttttaaacgtgccggtgccacaggtatatttacctatgcagctcttgaagta
gctgaaatattaaagaacaataaaattaggtacaaaatggcttctgatataaaataa

DBGET integrated database retrieval system