KEGG   Rickettsia rickettsii Colombia: RPL_06085Help
Entry
RPL_06085         CDS       T01722                                 

Definition
(GenBank) anhydromuramoyl-peptide exo-beta-N-acetylglucosaminidase
  KO
K05349  beta-glucosidase [EC:3.2.1.21]
Organism
rrc  Rickettsia rickettsii Colombia
Pathway
rrc00460  Cyanoamino acid metabolism
rrc00500  Starch and sucrose metabolism
rrc01100  Metabolic pathways
rrc01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:rrc00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    RPL_06085
  09106 Metabolism of other amino acids
   00460 Cyanoamino acid metabolism
    RPL_06085
Enzymes [BR:rrc01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.21  beta-glucosidase
     RPL_06085
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_3 Gp_dh_N
Motif
Other DBs
NCBI-ProteinID: AFB24014
Position
complement(1020416..1021360)
Genome map
AA seq 314 aa AA seqDB search
MTIRQMVKPVIIGISGPELTDAERELFEEHNPLGVVLFRRNIRKNDNGAQVKEALIKLIA
DIKEVLGENTIISIDQEGGRVQRLIAPTFYDAPAAQTFTDPQACKQNYSDIAKELREVGI
NLDFAPVADLLHEGADKIVGDRSFGGEPEVVVPLCLAAIDGLQEEKVGACIKHIPGHGRA
TVDSHKKLPIVDVDIEELAKTDFKVFKELAKHDNIKLAMTAHIIYKALDPENPATLSKKV
IDYIKNNIGFKGLIISDAIDMKALSGSMADMTKEVLDAGVDIVLECTGEFNKMSEVLCSV
SESSIDKFSDLFIA
NT seq 945 nt NT seq  +upstreamnt  +downstreamnt
atgacaataagacaaatggtaaagccagtaattataggtatatctggtcctgaattaacc
gatgccgaaagagaattatttgaagagcataatcctttaggtgtagttttattccgtcgt
aatattagaaagaatgataacggtgcgcaggttaaagaagcccttattaagcttattgca
gatataaaagaagtattaggggaaaatactatcatctctatagatcaagaaggcggtagg
gtacaaaggcttatagcaccgactttttatgacgctccggctgctcaaacttttactgat
ccccaagcatgtaaacaaaattatagtgatattgcgaaagagctgagagaagtaggcatt
aatctagattttgcaccggtagcggatttgctccacgaaggagcagacaagatagtcggc
gatagaagttttggtggggagccggaagtagtcgtgcctttatgtttagctgctatagac
ggattacaagaagagaaagtcggggcttgtataaaacatattccgggccatggtagagct
acggtggatagccataaaaaattaccgattgtcgatgttgatatagaagagttagcaaaa
acagactttaaagtatttaaggagctcgcgaagcacgataatattaaacttgctatgacg
gcacatataatttataaagctcttgatcctgagaatcctgccaccctatcaaaaaaagtg
atagactatattaaaaataatatcggctttaaagggctgattatttccgatgcaatagat
atgaaagctttaagcggtagtatggcagatatgaccaaagaagttttagatgcaggcgta
gatatagtacttgaatgtaccggagaatttaacaaaatgtctgaagttctatgtagtgtt
tcggaaagttctatagataaattttctgacttgtttattgcgtaa

DBGET integrated database retrieval system