KEGG   Rickettsia rhipicephali: MCC_01580Help
Entry
MCC_01580         CDS       T01786                                 

Gene name
aspS
Definition
(GenBank) aspartyl-tRNA synthetase
  KO
K01876  aspartyl-tRNA synthetase [EC:6.1.1.12]
Organism
rre  Rickettsia rhipicephali
Pathway
rre00970  Aminoacyl-tRNA biosynthesis
Brite
KEGG Orthology (KO) [BR:rre00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    MCC_01580 (aspS)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:rre01007]
    MCC_01580 (aspS)
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:rre03016]
    MCC_01580 (aspS)
   03029 Mitochondrial biogenesis [BR:rre03029]
    MCC_01580 (aspS)
Enzymes [BR:rre01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.12  aspartate---tRNA ligase
     MCC_01580 (aspS)
Amino acid related enzymes [BR:rre01007]
 Aminoacyl-tRNA synthetase
  Class II (A)
   MCC_01580 (aspS)
Transfer RNA biogenesis [BR:rre03016]
 Eukaryotic Type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    MCC_01580 (aspS)
 Prokaryotic Type
   Other AARSs
    MCC_01580 (aspS)
Mitochondrial biogenesis [BR:rre03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    MCC_01580 (aspS)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: tRNA-synt_2 GAD tRNA_anti-codon
Motif
Other DBs
NCBI-ProteinID: AFC71969
Position
275201..277009
Genome map
AA seq 602 aa AA seqDB search
MHKYRTHNCNELQISDVEKEVKLSGWVHRRRDHGNLVFIDLRDHYGITQIVFTDQNPQLM
EDASRLRYESVITVRGTVVARSEDTINNTLPTGHVEVLAVEFSVESAADTLPFVINTEKD
VPEESRLKHRFLDLRREKLHNNIILRSQIISHIRHLMTASGFTEFQTPILTASSPEGARD
FLVPSRMHPGKFYALPQAPQQFKQLLMVSGFDRYFQIAPCFRDEDARADRSPGEFYQLDV
EMSFVTQEDVFSTLEPVMYDLFTKFTDKKVSETPFVCIPYNESMLKYGSDKPDLRNPIII
ADVTEIFRDSDFTIFRENIKKGSIVRAIPAPKAAALPRSFFDKMIEFAISEGAGGLGYIQ
FSETGEAKGPVVKFLSPQQLESLKATASISNGDAVFFASDKKEKAAKLAGKVRIRLGEEL
DLLEKDCFKFCWITDFPFYELNEETGKIDFSHNPFSMPQGGIDALEQAKTTEELLELTAY
QYDIVCNGIELSSGAIRNHKPEIMYKAFSIAGYSEEEVDKRFGGMIRAFKFGAPPHGGIA
PGIDRIVMLLAEATNIREIIAFPLNQQAEDLLMNAPSYVEDKALKELSIMLSPSARKNAG
KE
NT seq 1809 nt NT seq  +upstreamnt  +downstreamnt
atgcataaatacagaactcataattgtaacgaattacaaatatccgatgtagaaaaagaa
gttaagctatccggttgggtacatagaagaagagatcacgggaatctagtttttatagat
ttacgtgatcattacggtataactcaaatcgtgtttaccgatcaaaaccctcagcttatg
gaggatgcaagtcgtttgcgttatgagtcggtaattacggtaaggggtacagttgtagca
agatcagaggacacgattaataatacgcttccgacaggtcatgttgaagtgctagctgtg
gaatttagtgttgagtcagctgcggacactctaccttttgttattaataccgaaaaagac
gttcccgaagagtctaggcttaaacatcgctttttagatcttagacgtgagaaattacat
aataatataatactccgctcacaaattatttctcatattcgtcatttgatgacggcaagc
ggttttaccgaatttcaaactccgattttaacagcaagctcacctgagggggctagggat
tttttagtaccgagtagaatgcatccgggtaagttctatgcattaccgcaagcacctcag
caattcaaacagttattgatggtatcaggctttgatcgttattttcaaattgctccttgt
tttcgggatgaagatgcaagagccgatagatcacccggcgagttttatcagctagatgta
gaaatgtcgtttgttacacaggaagatgtatttagtactcttgagcctgtgatgtatgat
ttattcactaaattcacggataagaaagtatcagagactcctttcgtttgtattccatat
aatgaatctatgctaaaatacggctctgataagcctgatttgcgtaaccctattataatt
gccgatgtaactgagatatttagagattccgattttacaatctttagagagaatattaaa
aaaggtagcatagttcgtgcaattcctgcacctaaggcagctgcactgcctcgtagtttc
ttcgataaaatgatagagtttgcgatatcagaaggagcaggtggacttggctatattcag
tttagtgaaaccggtgaagcaaaaggaccggtagtaaaattcttaagcccgcagcaatta
gagagtctaaaagctacagctagtattagtaacggtgatgctgtatttttcgctagcgat
aagaaagagaaagctgctaaacttgccggtaaggttagaataagacttggtgaagagctt
gatttacttgaaaaagattgttttaaattctgctggattaccgattttccattctatgag
ttaaatgaagaaacaggaaaaattgattttagccataatccgttttctatgccgcagggc
ggaatagatgctttagagcaagctaaaaccactgaagagttattagaacttaccgcatac
caatatgatattgtttgtaacggtattgaactttccagcggtgctattagaaaccataag
ccggaaattatgtataaagcattttccatagcaggttatagtgaagaggaagttgataag
agatttggagggatgattagagcatttaagtttggagctccaccacatggtggaatagcc
cccggtattgaccgaatcgttatgctgcttgcggaagcaacaaatataagggaaataatt
gcgtttcctttaaaccagcaagctgaagatttactaatgaacgccccaagctatgtagag
gataaagctctaaaagagctaagcattatgctctcaccgtctgctagaaaaaatgcagga
aaagaataa

DBGET integrated database retrieval system