KEGG   Rickettsia rhipicephali: MCC_06590Help
Entry
MCC_06590         CDS       T01786                                 

Definition
(GenBank) Beta-glucosidase
  KO
K05349  beta-glucosidase [EC:3.2.1.21]
Organism
rre  Rickettsia rhipicephali
Pathway
rre00460  Cyanoamino acid metabolism
rre00500  Starch and sucrose metabolism
rre01100  Metabolic pathways
rre01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:rre00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    MCC_06590
  09106 Metabolism of other amino acids
   00460 Cyanoamino acid metabolism
    MCC_06590
Enzymes [BR:rre01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.21  beta-glucosidase
     MCC_06590
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_3 EspA
Motif
Other DBs
NCBI-ProteinID: AFC72798
Position
complement(1111388..1112332)
Genome map
AA seq 314 aa AA seqDB search
MTIRQMVKPVIIGISGPELTDAERALFEEHNPLGVILFRRNIRKNDNGVQDKEALIKLIA
DIKEVLGENTIISIDQEGGRVKRLIAPTFYDAPAAQTFTDPQACKQNYSDIAKALREVGI
NLDFAPVADLIHEGGDKIVGDRSFGGEPEVVVPLCLAAIDGLQEEKVRACIKHIPGHGRA
TVDSHKKLPIVDTDIEELEKTDFKVFKELAKHDNIKLAMTAHIIYKALDPENPATLSKKV
IDYIKNNIGFKGLIISDAIDMKALSGSMADMTKAVLDAGVDIVLECSREFNKMSEVLGSV
SESSIDKFSDLFIA
NT seq 945 nt NT seq  +upstreamnt  +downstreamnt
atgacaataagacaaatggtaaagccagtaattataggtatctctggtcctgaattaacc
gatgccgaaagagcattatttgaagagcataatcctttaggtgtaattttattccgtcgt
aatattagaaagaatgataatggtgtgcaggacaaagaagcccttattaagcttattgca
gatataaaagaagtattaggggaaaatactatcatctctatagatcaagaaggcggtaga
gtaaaaaggctcatagcaccgactttttatgacgctccggctgctcaaacttttactgat
ccccaagcatgtaaacaaaattatagtgatattgcgaaagcgctgagagaagtaggcatt
aatctagattttgcaccggtagcggatttgatccacgaaggaggagacaagatagtcggc
gatagaagtttcggcggggagccggaagtagtcgtgcctttatgtttagctgctatagac
ggattacaagaagagaaagtcagggcttgtataaaacatattccgggccatggtagagct
acggtggatagccataaaaaattaccgattgtcgatactgatatagaagagttagaaaaa
acagactttaaagtatttaaggagctagcgaagcacgataatattaaacttgctatgacg
gcacatataatttacaaagctcttgatcctgagaatcctgctaccctatcaaaaaaagtt
atagactatattaaaaataatatcggctttaaagggcttattatttccgatgcaatagat
atgaaagctttaagcggtagtatggcagatatgaccaaagcagttttagatgcaggcgta
gatatagtgcttgaatgtagcagagaatttaacaaaatgtctgaagttctaggtagtgtt
tcggaaagttctatagataaattttctgacttgtttattgcttaa

DBGET integrated database retrieval system