KEGG   Rhodospirillum rubrum F11: F11_01330Help
Entry
F11_01330         CDS       T02006                                 

Definition
(GenBank) 4-diphosphocytidyl-2-C-methyl-D-erythritol kinase
  KO
K00919  4-diphosphocytidyl-2-C-methyl-D-erythritol kinase [EC:2.7.1.148]
Organism
rrf  Rhodospirillum rubrum F11
Pathway
rrf00900  Terpenoid backbone biosynthesis
rrf01100  Metabolic pathways
rrf01110  Biosynthesis of secondary metabolites
rrf01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:rrf00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    F11_01330
Enzymes [BR:rrf01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.148  4-(cytidine 5'-diphospho)-2-C-methyl-D-erythritol kinase
     F11_01330
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GHMP_kinases_C GHMP_kinases_N
Motif
Other DBs
NCBI-ProteinID: AEO46736
Position
complement(326226..327140)
Genome map
AA seq 304 aa AA seqDB search
MTAVFPAADSVIEAACAKVNLTLHVTGRRANGYHDLDSLVVFSGAHDTLIACPAEGLSLA
MTGPTAALLDAEDDNIILRAARRLAERAGHRPDARLTLIKRLPVAAGIGGGSADGAATLR
ALSRLWKIALPQAEMLTLAAELGADVPVCLVGKAVTMAGIGDHLTPAPPLPEAWLLLVNP
RRAVPTPQVFKARQGGFSAANPLTESPASAQALAEALKRRTNDLAEPARRIEPVIDEVLR
TLAALPGCLLARMSGSGATCFGLFADQTSADFGMASLRETHGSWWASADRLIGDTARVPA
ALAV
NT seq 915 nt NT seq  +upstreamnt  +downstreamnt
atgacagcagtctttcccgccgccgacagcgtgatcgaagcggcctgcgccaaggtcaat
ctgacccttcacgtgaccgggcggcgcgccaatggctatcacgacctcgacagtctggtg
gttttcagcggcgcccacgacacgctgatcgcctgcccggccgaagggctgtcgcttgcc
atgaccggccccaccgccgccctgctcgacgccgaagacgacaacatcattctgcgggcg
gcgcggcggctggccgagcgcgccggtcaccggcccgatgcccggttaaccctgatcaag
cgcctaccggtcgccgccggcatcggtggcggctcggccgatggcgcggcgaccctgcgg
gcgctgtcgcgcttgtggaagatcgccctgccgcaagccgagatgctgaccctagccgcc
gagctgggcgccgatgtgccggtgtgcctggtcggcaaggccgtgaccatggccggcatc
ggcgaccatctgacccccgccccgcccctgcccgaagcttggctgctgctggtcaatccg
cgtcgggcggtgcccacgccccaggtgttcaaggcccgccagggcggcttttccgccgcc
aacccgttgacggaaagcccggccagcgcccaggccctggccgaggcgctcaaacggcgg
accaacgacctcgccgaaccggcccgtcggatcgagccggtgatcgacgaggtcttgcgc
accctcgcggctctgccgggttgcctgctcgcccgcatgtcgggcagcggcgccacctgc
tttggtctgttcgccgaccagacctccgccgatttcggcatggcttcattgcgtgaaacg
catgggtcatggtgggcctcggccgaccgcctgatcggcgataccgcccgggttcccgcc
gcgcttgcggtttga

DBGET integrated database retrieval system