KEGG   Rhodospirillum rubrum F11: F11_07590Help
Entry
F11_07590         CDS       T02006                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
rrf  Rhodospirillum rubrum F11
Pathway
rrf00071  Fatty acid degradation
rrf00072  Synthesis and degradation of ketone bodies
rrf00280  Valine, leucine and isoleucine degradation
rrf00310  Lysine degradation
rrf00362  Benzoate degradation
rrf00380  Tryptophan metabolism
rrf00620  Pyruvate metabolism
rrf00630  Glyoxylate and dicarboxylate metabolism
rrf00640  Propanoate metabolism
rrf00650  Butanoate metabolism
rrf00900  Terpenoid backbone biosynthesis
rrf01100  Metabolic pathways
rrf01110  Biosynthesis of secondary metabolites
rrf01120  Microbial metabolism in diverse environments
rrf01130  Biosynthesis of antibiotics
rrf01200  Carbon metabolism
rrf01212  Fatty acid metabolism
rrf02020  Two-component system
Brite
KEGG Orthology (KO) [BR:rrf00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    F11_07590
   00630 Glyoxylate and dicarboxylate metabolism
    F11_07590
   00640 Propanoate metabolism
    F11_07590
   00650 Butanoate metabolism
    F11_07590
  Lipid metabolism
   00071 Fatty acid degradation
    F11_07590
   00072 Synthesis and degradation of ketone bodies
    F11_07590
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    F11_07590
   00310 Lysine degradation
    F11_07590
   00380 Tryptophan metabolism
    F11_07590
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    F11_07590
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    F11_07590
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    F11_07590
Enzymes [BR:rrf01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     F11_07590
Exosome [BR:rrf04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   F11_07590
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt
Motif
Other DBs
NCBI-ProteinID: AEO47988
Position
complement(1736050..1737225)
Genome map
AA seq 391 aa AA seqDB search
MNDIVIAAAARTAVGAFTGSLSSLPAHSLGASVITDLLTRGKIAAGEIDDVLLGQVLTAA
QGQNPARQAAIAAGLPASSTALTINQVCGSGLRAVALGAQAIACGDAEVVIAGGQESMSL
APHAVLLRAGVKMGPAEMVDTMIKDGLWEAFHGYHMGITAETVAQAFGIDRATQDAFALA
SQQKAAAAQREGRFVDEIVAVCVRSRKGEVLVDSDEHLKPDTTAQSLAKLRPAFTKDGTV
TAGNASGLNDGAAGVLLMSAENAAKRGVTPLARVVSWATAGVDPAVMGTGPIPASRKALA
KAGWTIDDLDLIEANEAFAAQAIAVNREMGWDTAKVNVNGGAIAIGHPIGASGARILVSL
LHEMTRRDAKKALATLCIGGGMGIALCVERP
NT seq 1176 nt NT seq  +upstreamnt  +downstreamnt
atgaacgacatcgtcatcgccgccgccgcgcgcaccgccgtcggcgccttcaccgggtct
ttgtccagccttcccgcccatagcctgggcgccagcgtcatcaccgacctgctcacgcgc
ggcaagatcgccgccggcgagatcgacgacgtgctgcttggtcaggtcctgaccgccgcc
cagggccagaacccggcccgccaagccgccatcgccgccggactgccggcgtcaagcacc
gccttgacgatcaatcaggtctgcggttcggggctgcgcgccgtcgcccttggcgcccag
gccatcgcctgcggcgatgccgaggtggtgatcgccggcgggcaggaatcgatgagcctc
gccccccacgccgtcttgctgcgcgccggggtgaaaatggggccggccgaaatggtcgac
accatgatcaaggacggcctgtgggaggccttccacggctatcacatgggcatcaccgcc
gaaaccgtcgcccaggccttcggcatcgaccgcgccacccaggacgccttcgccctcgcc
tcgcagcaaaaagccgccgccgcccagcgcgagggacgcttcgtcgacgagatcgttgcg
gtctgcgtgcgcagccgcaagggcgaggtcctggtcgacagcgatgagcacctgaagccc
gataccaccgcccagagcctggccaaactgcgcccggccttcaccaaggatggcacggtc
accgccggcaacgcctcggggcttaacgacggcgccgccggggttttgctgatgagcgcc
gaaaacgccgccaaacgcggggtgacgccgcttgcccgcgtcgtatcctgggccaccgcc
ggcgtcgatcccgccgtgatgggcaccgggccgatcccggcctcgcgcaaggccctggcc
aaggccggctggaccatcgacgacctggatctgatcgaggccaacgaggctttcgccgcc
caggcgatcgccgtcaaccgcgagatgggctgggataccgcgaaggtcaacgtcaatggc
ggcgccatcgccatcggccatcccatcggcgcctcgggcgcgcgcatcctggtcagcctg
ctccatgaaatgacccggcgtgacgcgaaaaaggccctggcgacgctgtgcatcggcggc
ggcatgggcatcgcgctctgcgtcgaacggccctaa

DBGET integrated database retrieval system