KEGG   Rhodospirillum rubrum F11: F11_09430Help
Entry
F11_09430         CDS       T02006                                 

Definition
(GenBank) enoyl-CoA hydratase/isomerase
  KO
K01692  enoyl-CoA hydratase [EC:4.2.1.17]
Organism
rrf  Rhodospirillum rubrum F11
Pathway
rrf00071  Fatty acid degradation
rrf00280  Valine, leucine and isoleucine degradation
rrf00281  Geraniol degradation
rrf00310  Lysine degradation
rrf00360  Phenylalanine metabolism
rrf00362  Benzoate degradation
rrf00380  Tryptophan metabolism
rrf00410  beta-Alanine metabolism
rrf00627  Aminobenzoate degradation
rrf00640  Propanoate metabolism
rrf00650  Butanoate metabolism
rrf00903  Limonene and pinene degradation
rrf01100  Metabolic pathways
rrf01110  Biosynthesis of secondary metabolites
rrf01120  Microbial metabolism in diverse environments
rrf01130  Biosynthesis of antibiotics
rrf01212  Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:rrf00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    F11_09430
   00650 Butanoate metabolism
    F11_09430
  Lipid metabolism
   00071 Fatty acid degradation
    F11_09430
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    F11_09430
   00310 Lysine degradation
    F11_09430
   00360 Phenylalanine metabolism
    F11_09430
   00380 Tryptophan metabolism
    F11_09430
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    F11_09430
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    F11_09430
   00281 Geraniol degradation
    F11_09430
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    F11_09430
   00627 Aminobenzoate degradation
    F11_09430
   00930 Caprolactam degradation
    F11_09430
Enzymes [BR:rrf01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     F11_09430
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ECH_2 ECH_1
Motif
Other DBs
NCBI-ProteinID: AEO48352
Position
complement(2130827..2131903)
Genome map
AA seq 358 aa AA seqDB search
MSDDDILFEQKGALGAITLNRPRALNALTLPKVERMDRALRAWATDKTVGVVTVEGSGGR
AFCAGGDVRALAEVGKNGASAFLDAFFGQEYRLNRLIKTYPKPYVALLGGITMGGGVGIS
IHGRFPVATEATLIAMPETGIGMFPDVGGTYFLPRCPGATGVYLALTGARIGAADAVALG
LCTHHIPLSALEAVKEALAALDADAGADGVKAVLDGFHRDPGEAPLAPRRAAIARCFGQP
TLEDILAALASEAAIGDRAWAEETRAGLLAKSPFATRVTFEQLRRGATLDFDGCMALEYR
MAPRIARHPDFIEGVRALLVDKDNQPRWSAKALAEVEDAAVGALFAPRADGDLEFRDP
NT seq 1077 nt NT seq  +upstreamnt  +downstreamnt
atgagcgacgacgacatcctgtttgagcaaaagggcgccttgggcgccatcacccttaac
cggccgcgcgccctgaacgccctgaccctgcccaaggtcgagcggatggaccgcgccctg
cgcgcctgggccaccgataagacggtgggcgtggtcacggtcgaagggtcgggcggccgg
gcgttttgcgccggtggcgatgtccgcgccctggctgaggtcggcaaaaatggcgcgagc
gcctttctggatgccttcttcggccaggaatatcgcctcaaccgcctgatcaagacctat
cccaagccctatgtcgccctgctcggcggcatcaccatgggcggcggggtgggcatttcg
atccatggccgctttcctgtggccaccgaagccaccctcatcgccatgcccgaaaccggc
atcggcatgttccccgatgtcggcggcacctattttctgccgcgctgcccgggggcgacg
ggggtttatctggccctgaccggagcgcggatcggcgcggccgacgcggtcgctttgggg
ttgtgcacccaccatatccccttaagcgccctggaggcggtcaaggaggccctggcggct
ttggacgcggacgccggagccgacggggtgaaggcggtgcttgacggcttccaccgcgat
ccgggcgaggcgccgctggcacccaggcgcgccgccatcgcccgctgtttcggccagccc
accctcgaggacatcctggccgccctggccagcgaggcggcgatcggcgatcgggcctgg
gcggaggaaacccgggccggcctgttggcgaaatcgcccttcgccacgcgggtgaccttc
gagcaattgcgccggggcgccaccctcgatttcgacggctgcatggccttggaataccgc
atggcgccgcgcatcgcccgccatcccgatttcatcgaaggcgtgcgcgccctgcttgtc
gataaggacaaccagccgcggtggtcggccaaggccctcgccgaggtcgaggacgccgcc
gtcggagcgctgttcgcgccgcgtgccgatggcgatctggagtttcgcgacccttaa

DBGET integrated database retrieval system