KEGG   Rhodospirillum rubrum F11: F11_09710Help
Entry
F11_09710         CDS       T02006                                 

Definition
(GenBank) triosephosphate isomerase
  KO
K01803  triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
rrf  Rhodospirillum rubrum F11
Pathway
rrf00010  Glycolysis / Gluconeogenesis
rrf00051  Fructose and mannose metabolism
rrf00562  Inositol phosphate metabolism
rrf00710  Carbon fixation in photosynthetic organisms
rrf01100  Metabolic pathways
rrf01110  Biosynthesis of secondary metabolites
rrf01120  Microbial metabolism in diverse environments
rrf01130  Biosynthesis of antibiotics
rrf01200  Carbon metabolism
rrf01230  Biosynthesis of amino acids
Module
rrf_M00002  Glycolysis, core module involving three-carbon compounds
rrf_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:rrf00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    F11_09710
   00051 Fructose and mannose metabolism
    F11_09710
   00562 Inositol phosphate metabolism
    F11_09710
  Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    F11_09710
Enzymes [BR:rrf01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     F11_09710
Exosome [BR:rrf04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   F11_09710
  Exosomal proteins of bladder cancer cells
   F11_09710
  Exosomal proteins of melanoma cells
   F11_09710
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TIM Urocanase_N
Motif
Other DBs
NCBI-ProteinID: AEO48408
Position
complement(2188255..2189013)
Genome map
AA seq 252 aa AA seqDB search
MTVRRPLIAGNWKMNGLKAEGQGLARDLAQRLNKAGGVDFDLLLCPPFPLISTVVGAVAG
SGIAVGGQDCHAKAKGAHTGDVSAPMLADLGCQFVIVGHSERRADHGETDALVKAKAEAA
LAAGLIAVICVGETEAQRDAGETLAVVSGQLAGSLPTHADSGKVVIAYEPVWAIGTGRVP
TTEDVAKVHGALRKDLVGALGADGNGVRLLYGGSVKPDNAAELMALENVDGALVGGASLK
AEDFWAIAQSCA
NT seq 759 nt NT seq  +upstreamnt  +downstreamnt
atgaccgtgcgtcgtccgcttattgccggaaactggaagatgaacggcctcaaggccgag
ggccagggcctcgcccgggatcttgcccagaggcttaacaaggccggtggggtcgatttc
gaccttcttctttgtccgccttttccgttgatcagcacggtggtcggcgccgtggccgga
tcgggcatcgccgttggcggccaggattgccatgccaaggccaagggcgcccatacgggc
gatgtctcggccccgatgctggccgatctcggctgccagttcgtcatcgtcggccattcg
gaacgccgggccgatcacggcgaaaccgatgccctggtcaaggccaaggccgaggccgcc
ctggccgccggtctgatcgccgtgatctgcgtcggcgagaccgaggcccagcgcgacgcc
ggggaaaccctggccgtggtctcgggccaattggccggatcgttgcccacccacgcggat
tcgggcaaggtggtcatcgcctatgaacccgtctgggccatcggtaccggtcgcgtgccg
acgaccgaggatgtcgccaaggtccatggcgcgctgcgcaaggatctggtcggcgccctg
ggggcggacggcaatggcgtgcgcctgctttacggcggatcggtcaagcccgacaacgcc
gccgagctgatggccttggaaaacgtcgatggcgccctggtcggcggcgccagcctcaag
gccgaggatttctgggcgatcgcccagtcctgcgcttaa

DBGET integrated database retrieval system