KEGG   Rhodospirillum rubrum F11: F11_10000Help
Entry
F11_10000         CDS       T02006                                 

Definition
(GenBank) acetyl-CoA C-acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
rrf  Rhodospirillum rubrum F11
Pathway
rrf00071  Fatty acid degradation
rrf00072  Synthesis and degradation of ketone bodies
rrf00280  Valine, leucine and isoleucine degradation
rrf00310  Lysine degradation
rrf00362  Benzoate degradation
rrf00380  Tryptophan metabolism
rrf00620  Pyruvate metabolism
rrf00630  Glyoxylate and dicarboxylate metabolism
rrf00640  Propanoate metabolism
rrf00650  Butanoate metabolism
rrf00900  Terpenoid backbone biosynthesis
rrf01100  Metabolic pathways
rrf01110  Biosynthesis of secondary metabolites
rrf01120  Microbial metabolism in diverse environments
rrf01130  Biosynthesis of antibiotics
rrf01200  Carbon metabolism
rrf01212  Fatty acid metabolism
rrf02020  Two-component system
Brite
KEGG Orthology (KO) [BR:rrf00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    F11_10000
   00630 Glyoxylate and dicarboxylate metabolism
    F11_10000
   00640 Propanoate metabolism
    F11_10000
   00650 Butanoate metabolism
    F11_10000
  09103 Lipid metabolism
   00071 Fatty acid degradation
    F11_10000
   00072 Synthesis and degradation of ketone bodies
    F11_10000
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    F11_10000
   00310 Lysine degradation
    F11_10000
   00380 Tryptophan metabolism
    F11_10000
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    F11_10000
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    F11_10000
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    F11_10000
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:rrf04147]
    F11_10000
Enzymes [BR:rrf01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     F11_10000
Exosome [BR:rrf04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   F11_10000
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt
Motif
Other DBs
NCBI-ProteinID: AEO48466
Position
complement(2254521..2255741)
Genome map
AA seq 406 aa AA seqDB search
MSSAAPSAFPFSAGDPVVIVGAKRTPLGAFMGSLGSLRAPELGARAISGALDGLEGAEHR
VDGVIMGCVLPAGQGQAPARQAAHAAGLSWAVPCATVNKMCGSGMEAAILACNTLAAGAA
EVMVAGGMESMTNAPYLLDKARGGHRLGHGQVVDHMFLDGLEDAYDRGRLMGTFAEDTAQ
SYRFSREEQDAFALESLLRAKRAIADGVMARECVSVVVRERGEDHLVETDEAPIKANPDR
IPHLKPAFREGGTVTAANSSSISDGAAALVLTRASVADRAGWRPLAVVRGHAAYAAEPEL
FPTAPVGAIERMLARVGWRRDEVDLWEINEAFAVVALVALRDLGLDPGRLNVHGGACALG
HPIGASGARIIVTLLNALRQRGLTRGVASLCIGGGEATAMAVELAS
NT seq 1221 nt NT seq  +upstreamnt  +downstreamnt
atgtcgtctgccgcccccagcgccttcccgttttccgccggtgatccggtggtgattgtc
ggcgccaaacgcacgccgcttggcgccttcatgggatcgctggggtccttgcgcgcgccc
gaactgggggcgagggcgatcagcggcgcgctggacgggctggagggggcggagcatcgc
gttgacggggtgatcatgggctgcgttctgcccgccggccaggggcaggcgccggcccgt
caggccgcccatgcggcggggctgtcgtgggcggtgccctgcgccacggtcaacaagatg
tgcgggtcggggatggaggcggcgatcctggcttgcaataccctggccgccggcgccgcc
gaggtgatggtggccggcggcatggaaagcatgaccaacgccccctatcttctggacaag
gcacgcggcggccatcggttgggccatggtcaggtggtcgatcacatgttccttgatgga
ctggaagacgcctatgaccggggccggctgatgggaaccttcgccgaggatacggcgcaa
agctatcggttcagtcgcgaggagcaggacgccttcgccctcgagtcgctgttgcgggcc
aagcgcgccatcgccgacggcgtgatggcgcgggaatgcgtgagcgtggtcgtgcgcgag
cgcggcgaggatcatctggtcgagaccgacgaggcgccgatcaaggccaatcccgaccgc
atcccccacttgaagccggccttccgcgagggcgggacggtgacggcggccaatagctcg
tcgatctcggatggggcggcggcgctggtgctgacccgggcctcggtggccgaccgggcg
ggatggaggcccttggccgtggtgcgcggccatgcggcctatgcggccgaacccgaattg
tttccaaccgcgccggtcggggcgatcgaacggatgctggcgcgggtgggctggcggcgc
gacgaggtggatttgtgggagatcaacgaagccttcgccgttgtcgccctggtggcgctg
cgcgacctcggtctcgaccccgggcgtttgaacgttcatggtggagcctgcgccctgggc
catccgatcggcgcctcgggcgcgcggatcatcgtcaccttgctcaacgccctgcgccag
cggggtttgacgcggggggtggcctcgctgtgcatcggtggcggcgaggcgacggcgatg
gccgtggaacttgcgtcatag

DBGET integrated database retrieval system