KEGG   Rhodospirillum rubrum F11: F11_12770Help
Entry
F11_12770         CDS       T02006                                 

Definition
(GenBank) glucokinase
  KO
K00845  glucokinase [EC:2.7.1.2]
Organism
rrf  Rhodospirillum rubrum F11
Pathway
rrf00010  Glycolysis / Gluconeogenesis
rrf00052  Galactose metabolism
rrf00500  Starch and sucrose metabolism
rrf00520  Amino sugar and nucleotide sugar metabolism
rrf00521  Streptomycin biosynthesis
rrf01100  Metabolic pathways
rrf01110  Biosynthesis of secondary metabolites
rrf01120  Microbial metabolism in diverse environments
rrf01130  Biosynthesis of antibiotics
rrf01200  Carbon metabolism
Module
rrf_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:rrf00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    F11_12770
   00052 Galactose metabolism
    F11_12770
   00500 Starch and sucrose metabolism
    F11_12770
   00520 Amino sugar and nucleotide sugar metabolism
    F11_12770
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    F11_12770
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    F11_12770
Enzymes [BR:rrf01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     F11_12770
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glucokinase
Motif
Other DBs
NCBI-ProteinID: AEO49018
Position
2890015..2890989
Genome map
AA seq 324 aa AA seqDB search
MAEPFIPGLIADIGGTNARFALTTPEGGWRDERVYRCAAFPGPAEAAAHYLAEVLTAFEP
RPDRGAICVACPVNGDHLALTNHGAWSFSISAVADRLGLAPFHAVNDFIANALAIPRLGP
SGLIEIGGGAGLTGAPIAAIGPGTGLGVAILIPGRGGNRTSPLATEGGHVTLPAVTDREA
VIISALRAIHGHASAERAISGPGLVWLSEAIRAADGLEPVAETPPSVMEKGLARSCPVCA
EAVDTFYALLGTVAGNLVLSTGAQGGVYLMGGILPRHPEALRTSAFLARFHEKGRFRDYL
DVVPIRLVTHPYPAFIGLAGLVSD
NT seq 975 nt NT seq  +upstreamnt  +downstreamnt
atggctgagccgttcattcccggattgatcgccgatatcggcggcaccaacgcccgcttc
gccctgaccacccccgagggcggctggcgcgacgaacgggtttaccgctgcgccgccttt
cccggcccggccgaggcggcggcccattatctggccgaggtgctgaccgcctttgaaccg
cgccccgatcgcggggcgatctgcgtcgcctgtccggtcaacggcgatcatctggctttg
accaaccatggggcgtggtcgttctcgatcagcgcggtcgccgaccgcttgggtttggcg
cctttccatgcggtcaatgacttcatcgccaacgccctggccatcccccgccttggcccc
tccgggctgatcgagatcggcggcggcgccggacttaccggggcgccgatcgccgcaatc
ggcccgggcaccggtctgggggtggcgatcctcatccccggtcgcggcggcaaccgcacc
agccccctggccaccgagggcggccatgtcaccctgcccgccgtgaccgaccgcgaggcg
gtgatcatcagcgccctgcgcgccattcacggccacgcctcggccgagcgggcgatttcc
ggccccggtctggtttggctgagcgaggcgatccgcgccgccgatggcttggagccggtt
gccgaaaccccgccctcggtgatggaaaagggcttggcgcgcagctgcccggtttgcgcc
gaagccgtcgacaccttttacgcgctgctgggcacggtggcgggcaatctggtgctgagc
accggcgcccagggcggcgtttacctgatgggaggtatcctgccccgacacccagaggcc
ttgcgaacctcggccttcctggcgcgcttccacgaaaagggccgcttccgcgattacctt
gatgtcgtccccattcgcttggtcacccacccctatccggccttcatcggtctggccggg
ctggtcagcgattag

DBGET integrated database retrieval system