KEGG   Rickettsia rickettsii Hauke: RPM_00965Help
Entry
RPM_00965         CDS       T01723                                 

Definition
(GenBank) succinate dehydrogenase hydrophobic membrane anchor protein
  KO
K00242  succinate dehydrogenase / fumarate reductase, membrane anchor subunit
Organism
rrh  Rickettsia rickettsii Hauke
Pathway
rrh00020  Citrate cycle (TCA cycle)
rrh00190  Oxidative phosphorylation
rrh00650  Butanoate metabolism
rrh01100  Metabolic pathways
rrh01110  Biosynthesis of secondary metabolites
rrh01120  Microbial metabolism in diverse environments
rrh01130  Biosynthesis of antibiotics
rrh01200  Carbon metabolism
Module
rrh_M00009  Citrate cycle (TCA cycle, Krebs cycle)
rrh_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
rrh_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:rrh00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    RPM_00965
   00650 Butanoate metabolism
    RPM_00965
  Energy metabolism
   00190 Oxidative phosphorylation
    RPM_00965
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sdh_cyt tRNA_anti_2 CybS PAP2 Fumarate_red_D Mem_trans Fumarate_red_C
Motif
Other DBs
NCBI-ProteinID: AFB29802
Position
170500..170877
Genome map
AA seq 125 aa AA seqDB search
MVYDFKAEIVKAKNSGSAKSGSHHWLLQRVTGIILALCSVWLIYFTLTNKNNDINIIMWA
LKKPFNVVALLITVVISLYHAMLGMRVVIEDYISCHKLRNTLIIIVQLFCIVTIVAFVVA
LFYKG
NT seq 378 nt NT seq  +upstreamnt  +downstreamnt
atggtatatgattttaaagcagaaattgtaaaagcaaaaaatagcggttctgctaaaagc
ggttctcatcattggttattgcagagagtaacggggattatattagctttatgttctgtg
tggctaatatattttacgttaaccaataaaaataatgatataaatattattatgtgggca
cttaaaaagccttttaatgtagtagctttgttaattacggtggttatttcgttgtatcat
gcgatgcttggtatgcgtgtagtaattgaagattatataagttgtcacaaattacgtaat
acattgattataatagtgcaattattttgcattgttactattgtagcttttgtagtagcg
ctgttttataaaggataa

DBGET integrated database retrieval system