KEGG   Rickettsia rickettsii Iowa: RrIowa_0210Help
Entry
RrIowa_0210       CDS       T00643                                 

Definition
(GenBank) succinate dehydrogenase membrane anchor subunit
  KO
K00242  succinate dehydrogenase / fumarate reductase, membrane anchor subunit
Organism
rrj  Rickettsia rickettsii Iowa
Pathway
rrj00020  Citrate cycle (TCA cycle)
rrj00190  Oxidative phosphorylation
rrj00650  Butanoate metabolism
rrj01100  Metabolic pathways
rrj01110  Biosynthesis of secondary metabolites
rrj01120  Microbial metabolism in diverse environments
rrj01130  Biosynthesis of antibiotics
rrj01200  Carbon metabolism
Module
rrj_M00009  Citrate cycle (TCA cycle, Krebs cycle)
rrj_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
rrj_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:rrj00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    RrIowa_0210
   00650 Butanoate metabolism
    RrIowa_0210
  Energy metabolism
   00190 Oxidative phosphorylation
    RrIowa_0210
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sdh_cyt tRNA_anti_2 CybS PAP2 Fumarate_red_D Mem_trans Fumarate_red_C
Motif
Other DBs
NCBI-ProteinID: ABY72123
UniProt: B0BW97
Position
170552..170929
Genome map
AA seq 125 aa AA seqDB search
MVYDFKAEIVKAKNSGSAKSGSHHWLLQRVTGIILALCSVWLIYFTLTNKNNDINIIMWA
LKKPFNVVALLITVVISLYHAMLGMRVVIEDYISCHKLRNTLIIIVQLFCIVTIVAFVVA
LFYKG
NT seq 378 nt NT seq  +upstreamnt  +downstreamnt
atggtatatgattttaaagcagaaattgtaaaagcaaaaaatagcggttctgctaaaagc
ggttctcatcattggttattgcagagagtaacggggattatattagctttatgttctgtg
tggctaatatattttacgttaaccaataaaaataatgatataaatattattatgtgggca
cttaaaaagccttttaatgtagtagctttgttaattacggtggttatttcgttgtatcat
gcgatgcttggtatgcgtgtagtaattgaagattatataagttgtcacaaattacgtaat
acattgattataatagtgcaattattttgcattgttactattgtagcttttgtagtagcg
ctgttttataaaggataa

DBGET integrated database retrieval system