KEGG   Rickettsia rickettsii Iowa: RrIowa_0219Help
Entry
RrIowa_0219       CDS       T00643                                 

Definition
(GenBank) LSU ribosomal protein L11P
  KO
K02867  large subunit ribosomal protein L11
Organism
rrj  Rickettsia rickettsii Iowa
Pathway
rrj03010  Ribosome
Brite
KEGG Orthology (KO) [BR:rrj00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    RrIowa_0219
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:rrj03011]
    RrIowa_0219
Ribosome [BR:rrj03011]
 Ribosomal proteins
  Mitochondria/ Chloroplast
   Large subunit
    RrIowa_0219
  Bacteria
    RrIowa_0219
  Archaea
    RrIowa_0219
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ribosomal_L11_N Ribosomal_L11
Motif
Other DBs
NCBI-ProteinID: ABY72131
UniProt: B0BWA5
Position
178307..178744
Genome map
AA seq 145 aa AA seqDB search
MSQKAIKGYINLIIPAAGATPAPPIGPALGQRKVNIAAFCKDFNDATQGMEKGIPLPTVI
TVYEDSSFSFKIKTPPASYFLKKYAKITKGSSATKKEAVVGKVTMDDCREIAKLKMPDLN
TKNIEAATKIICGSAASMGLEVVGN
NT seq 438 nt NT seq  +upstreamnt  +downstreamnt
atgtctcagaaagcaataaaaggttatattaacttgataattccagctgctggagccact
cctgcacctcctataggaccggccctaggacaaagaaaagttaatattgcagcattttgt
aaagattttaatgatgctacgcaaggtatggaaaaaggaatacctctgccaaccgtaatt
accgtttatgaagatagtagtttttcttttaaaataaaaactcctcctgcttcttacttt
ttaaagaaatatgctaaaattactaaaggttctagtgctactaaaaaagaagccgtagta
ggtaaagttactatggatgattgtcgtgaaattgcaaagttaaaaatgcctgatttaaat
acaaaaaatattgaagcagcaacaaaaattatttgtggtagtgctgcatctatgggactt
gaagtagtagggaattaa

DBGET integrated database retrieval system