KEGG   Rickettsia rickettsii Iowa: RrIowa_1050Help
Entry
RrIowa_1050       CDS       T00643                                 

Definition
(GenBank) UDP-N-acetylglucosamine 1-carboxyvinyltransferase
  KO
K00790  UDP-N-acetylglucosamine 1-carboxyvinyltransferase [EC:2.5.1.7]
Organism
rrj  Rickettsia rickettsii Iowa
Pathway
rrj00520  Amino sugar and nucleotide sugar metabolism
rrj00550  Peptidoglycan biosynthesis
rrj01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:rrj00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    RrIowa_1050
  Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    RrIowa_1050
Enzymes [BR:rrj01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.7  UDP-N-acetylglucosamine 1-carboxyvinyltransferase
     RrIowa_1050
Peptidoglycan biosynthesis and degradation proteins [BR:rrj01011]
 Precursor biosynthesis
  Transferase/Dehydrogenase
   RrIowa_1050
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: EPSP_synthase
Motif
Other DBs
NCBI-ProteinID: ABY72852
UniProt: B0BYC6
Position
complement(833306..834565)
Genome map
AA seq 419 aa AA seqDB search
MHKLIIHGGTPLKGSINISGAKNAVLPIMAASILTDKLHITNVPKLTDVSTMKDLLRSHG
ADIEIIKHQDEFELIIDTKNINNFTADYEIVRKMRASIWVLGPLLTKYGKAKVSLPGGCA
IGARQVDLHIAVLKAMGAEIEIEDGYINASSKGRLKGTHFVFDKVSVGATINAILVAVLA
EGETVLFNCGREPEIVDLCNCLITMGADIAGIGTSEITIKGKDSLNKASYKVLSDRIEAG
TYMFAAAITKGDVKICGIDYHIVENIALKLIETGIKVVPINNGVQVTYEGKLNSVDLETN
PYPGFATDLQAQFMSLMTLSSGVSMITENIFENRFMHVPELCRMGADIVVRGNKAVVRGV
EMLKGAEVMASDLRASVSLILAGLSTNSKTVLHRIYHLDRGFQDLEKKLSNCGADIKRV
NT seq 1260 nt NT seq  +upstreamnt  +downstreamnt
atgcacaaattgattattcacggtggtacacctctgaaaggtagtattaatattagcggt
gctaaaaatgccgtgctacctattatggcagcgtctattcttaccgataaactgcatatt
actaatgttccaaagttaacggatgttagtactatgaaagatttgctccgaagtcacggg
gcagatattgaaataataaaacatcaagatgaatttgagcttataattgataccaaaaat
ataaataactttactgcagattatgaaatagtccgtaaaatgagagcatcgatttgggtg
cttggtcctttgcttaccaaatacggtaaagcaaaagtatcgcttccgggtggttgtgct
attggagcaaggcaagtagatttgcatattgctgtattaaaagctatgggagctgagatt
gaaatagaagacggttatattaacgcttcaagtaaaggacgcttaaaaggtactcatttt
gtttttgataaagtttccgtaggtgctacgattaatgcaatacttgtagctgttttagca
gagggggaaactgtgctttttaattgtggtcgagagccggaaatagttgatttatgtaat
tgtcttatcacaatgggagccgatattgcaggtatcggcactagcgaaataacaattaaa
ggcaaggattctttaaataaagcgagctataaagtactttctgatcgtattgaagccggt
acttatatgtttgcggcagctattactaaaggtgatgtaaaaatttgtgggattgattac
catattgtagaaaatatagctttaaaacttatcgaaacgggtataaaagttgtgccgatc
aataacggagttcaagtaacttatgaagggaagttaaattcagtggatttagaaactaat
ccctatcctggctttgctactgatttgcaagcacaatttatgagccttatgacgcttagt
agcggtgtttcaatgatcaccgagaatatttttgaaaatcgtttcatgcatgttcctgaa
ttatgtagaatgggagcagatatagtagtacgaggtaataaggcggttgttcgaggtgta
gaaatgttaaaaggcgcagaagttatggcaagtgatcttagagcttcggtatcgctaata
ctcgctggtcttagtactaatagcaaaaccgtattacaccgaatatatcatttagatcgt
ggcttccaagatttagaaaaaaaattaagtaattgtggtgcagatataaaaagggtataa

DBGET integrated database retrieval system