KEGG   Rickettsia rickettsii Hino: RPJ_00500Help
Entry
RPJ_00500         CDS       T01738                                 

Gene name
ndk
Definition
(GenBank) mulitfunctional nucleoside diphosphate kinase/apyrimidinic endonuclease/3'-phosphodiesterase
  KO
K00940  nucleoside-diphosphate kinase [EC:2.7.4.6]
Organism
rrn  Rickettsia rickettsii Hino
Pathway
rrn00230  Purine metabolism
rrn00240  Pyrimidine metabolism
rrn01100  Metabolic pathways
rrn01110  Biosynthesis of secondary metabolites
Module
rrn_M00052  Pyrimidine ribonucleotide biosynthesis, UMP => UDP/UTP,CDP/CTP
Brite
KEGG Orthology (KO) [BR:rrn00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    RPJ_00500 (ndk)
   00240 Pyrimidine metabolism
    RPJ_00500 (ndk)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:rrn04131]
    RPJ_00500 (ndk)
Enzymes [BR:rrn01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.6  nucleoside-diphosphate kinase
     RPJ_00500 (ndk)
Membrane trafficking [BR:rrn04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Kinases and associated proteins
    RPJ_00500 (ndk)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NDK DUF4708
Motif
Other DBs
NCBI-ProteinID: AFB27056
Position
78911..79333
Genome map
AA seq 140 aa AA seqDB search
MTIQYTFSMIKPDAIKRNKIGQVNTYLENAGLKIVAQKMKFLTKYEAACFYDEHRARPFF
NSLVEYITSGAVVLQVLKGEDAITLNRTVMGATNPAEAEAGTIRKDLGESIEANSIHGSD
SENSAKREIEFFFNKSEIIE
NT seq 423 nt NT seq  +upstreamnt  +downstreamnt
atgacaatacaatatactttttcaatgattaagcctgatgctatcaaaaggaataaaata
gggcaagttaatacttacttagaaaatgccggtttaaaaatagtggctcagaaaatgaaa
tttttaactaaatatgaagctgcatgtttttatgatgagcatagagcaagaccgtttttt
aatagcttagttgaatatattacttcaggagcggtagtacttcaagtgcttaagggggag
gatgctataactttaaaccgcaccgttatgggtgcaactaatcctgctgaagctgaagca
ggcactattagaaaagatttaggcgaatcaattgaggctaatagtattcatggttcagat
agtgaaaatagtgcgaaaagagaaatcgaatttttctttaataaatctgaaattatagaa
taa

DBGET integrated database retrieval system