KEGG   Rickettsia rickettsii Hino: RPJ_02505Help
Entry
RPJ_02505         CDS       T01738                                 

Definition
(GenBank) glutamyl-tRNA synthetase
  KO
K01885  glutamyl-tRNA synthetase [EC:6.1.1.17]
Organism
rrn  Rickettsia rickettsii Hino
Pathway
rrn00860  Porphyrin and chlorophyll metabolism
rrn00970  Aminoacyl-tRNA biosynthesis
rrn01100  Metabolic pathways
rrn01110  Biosynthesis of secondary metabolites
rrn01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:rrn00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    RPJ_02505
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    RPJ_02505
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:rrn01007]
    RPJ_02505
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:rrn03016]
    RPJ_02505
  09183 Protein families: signaling and cellular processes
   02048 Prokaryotic defense system [BR:rrn02048]
    RPJ_02505
Enzymes [BR:rrn01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.17  glutamate---tRNA ligase
     RPJ_02505
Amino acid related enzymes [BR:rrn01007]
 Aminoacyl-tRNA synthetase
  Class I (A)
   RPJ_02505
Transfer RNA biogenesis [BR:rrn03016]
 Eukaryotic Type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    RPJ_02505
 Prokaryotic Type
   Other AARSs
    RPJ_02505
Prokaryotic defense system [BR:rrn02048]
 Toxin-antitoxin system (TA system)
  Type II TA system
   Type II TA system related factors
    RPJ_02505
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: tRNA-synt_1c DUF4105
Motif
Other DBs
NCBI-ProteinID: AFB27430
Position
complement(444543..445886)
Genome map
AA seq 447 aa AA seqDB search
MTKVITRFAPSPTGMLHVGNIRAALLNWLYAKKHNGQFILRFDDTDLERSKQEYKDAIEE
DLKFLNINWDQTFNQLSRLSRYDAIKNLLLDKKRLYACYETPEELELKRKFQLSKGLPPI
YDRASLNLTEEQAKKYIEQGRKPHYRFLVNHEPISWHDMIKGEVKYDGKALSDPIVIRAD
GSMTYMLCSVIDDIDYDITHIIRGEDHVSNTAIQMQMFEALNTTPPTFGHLSLIINKDEK
ISKRVGGFEIATLRKEIGIEAMAIASFFSLLGSSAQILPYKSMEKLANQFEISSFSKSPT
IYQPEDLERLNHKLLISLDFDTVKERLKEIDAEYIDENFWLSVSPNLQKLRDVKDWWEIC
HQTPNVENLNLDKEYLKQAAELLPKGEITKDSWSIWTKEITNITGRKGKELFLPLRLALT
ARESGPEIASVLPLIDREEIIKRLTSA
NT seq 1344 nt NT seq  +upstreamnt  +downstreamnt
atgacaaaagttataacacgatttgctccgtcaccgaccggtatgttacatgtcgggaat
atcagggcagcattgcttaactggctatatgcaaagaagcataacggacagtttatttta
agatttgacgatacggatttagagcgtagtaaacaggaatataaagacgctatcgaggaa
gatctaaaatttttaaatattaattgggatcagacatttaatcaattaagtcgtttaagt
agatatgatgcaatcaaaaatctattactagacaaaaaaagattatatgcctgctatgag
actcctgaagagctagaattaaagcgtaaatttcaattatctaaaggtttaccaccgatt
tatgatcgagctagcttaaatctcactgaagagcaagcaaagaaatatatagaacaagga
agaaaaccgcattatagatttttggtaaatcatgaaccgattagctggcatgatatgatc
aaaggcgaagttaaatatgacggcaaggctttaagcgacccaatagtgataagagcagac
ggtagtatgacctatatgttatgctcagttattgatgatattgattatgatattactcat
attattaggggtgaagatcacgttagcaataccgccattcaaatgcaaatgtttgaggct
ttaaatactactcctccgacttttgggcatttaagtttaataatcaataaagatgagaaa
atttctaaaagagttggagggtttgagatcgcaactcttagaaaagaaatcggaatcgaa
gctatggcaatcgctagcttttttagtttacttggttcatcagcacaaatcttaccttat
aaatcaatggagaagctagcaaatcaatttgagataagtagtttctctaaaagtccaact
atctatcagccggaagatttagaaagattaaatcataaattacttataagtttagatttt
gatacagtaaaagaacgccttaaagaaatagatgccgagtatattgatgaaaatttttgg
ttatcggtaagccctaacttgcaaaaattacgtgatgtaaaagattggtgggaaatttgc
catcaaactccgaatgtagaaaatctaaatttagataaggaatatttaaagcaagcagca
gaattattaccgaaaggtgaaatcactaaagatagctggagcatttggactaaagaaata
acaaatataacaggcaggaaaggtaaggagttatttttacctcttcgccttgctttaacc
gccagagaatcaggaccagaaatcgcaagcgttttacctttgattgatagagaagagata
ataaagcgtttaactagtgcgtga

DBGET integrated database retrieval system