KEGG   Rickettsia rickettsii Hino: RPJ_03305Help
Entry
RPJ_03305         CDS       T01738                                 

Definition
(GenBank) transcriptional regulatory protein
  KO
K07659  two-component system, OmpR family, phosphate regulon response regulator OmpR
Organism
rrn  Rickettsia rickettsii Hino
Pathway
rrn02020  Two-component system
Brite
KEGG Orthology (KO) [BR:rrn00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    RPJ_03305
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02022 Two-component system [BR:rrn02022]
    RPJ_03305
Two-component system [BR:rrn02022]
 OmpR family
  EnvZ-OmpR (osmotic stress response)
   RPJ_03305
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Response_reg Trans_reg_C Spore_GerAC AbiEi_3 DUF2124
Motif
Other DBs
NCBI-ProteinID: AFB27579
Position
complement(584881..585561)
Genome map
AA seq 226 aa AA seqDB search
MHTYKAHILIVDDDSRILALLKQFLNKNAFLVSTASSVIEAKNLLKTSNYDLIILDVMLP
EITGLDFATTIRDAGNNIPIVMLTALSEADDRVKGLEAGASDYITKPFEPRELLLRINNL
INNYNNFKKETNIIKFGNNFYNSDTKEFTKNNQIVSLSSTEQKLLEILIKNSGKSTSRFE
LSKIMGGLSMRSIDVQITRIRSKIEDNPKEPKYLKTVRNEGYALYI
NT seq 681 nt NT seq  +upstreamnt  +downstreamnt
atgcatacatacaaagcacatattttaatcgttgatgatgatagcagaatattagcactt
ttaaagcaatttttaaataaaaacgcgtttttagtatcaacggcaagctcagtcatagaa
gctaaaaatctattaaaaacttctaattatgatttaattattttagatgttatgttacct
gaaataacagggcttgattttgctactactataagggatgccggtaataatattcctata
gttatgcttactgctttatcggaagccgatgaccgtgttaaaggacttgaagccggtgcc
tctgattatataactaaaccttttgaaccgagagaattattacttcggataaataactta
atcaataattataataactttaaaaaagaaacgaatataattaaattcggcaataatttt
tataattccgatacaaaagaatttaccaagaataatcaaattgtatctcttagctctact
gaacaaaaattacttgagatattaataaaaaattccggtaaatctactagtcgttttgaa
ctgtcaaaaataatgggagggcttagtatgcgttctatcgatgtacaaattacaagaata
agaagcaaaatagaagacaacccaaaagagccgaaatatttaaaaactgtgcgtaatgag
ggctatgcactttatatctaa

DBGET integrated database retrieval system