KEGG   Rickettsia rickettsii Hino: RPJ_05930Help
Entry
RPJ_05930         CDS       T01738                                 

Gene name
clpX
Definition
(GenBank) ATP-dependent protease ATP-binding subunit ClpX
  KO
K03544  ATP-dependent Clp protease ATP-binding subunit ClpX
Organism
rrn  Rickettsia rickettsii Hino
Brite
Chaperones and folding catalysts [BR:rrn03110]
 Heat shock proteins
  HSP100
   RPJ_05930 (clpX)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AAA_2 zf-C4_ClpX AAA ClpB_D2-small Mg_chelatase AAA_5 RuvB_N MCM AAA_22 Sigma54_activat T2SSE AAA_16 TIP49 AAA_14 IstB_IS21 Sigma54_activ_2 AAA_18 PduV-EutP NACHT TsaE AAA_29 AAA_PrkA ResIII AAA_33 ABC_tran FtsK_SpoIIIE AAA_24 AAA_3 CRAL_TRIO_N RNA_helicase DEAD zinc_ribbon_10 AAA_19
Motif
Other DBs
NCBI-ProteinID: AFB28022
Position
complement(996938..998215)
Genome map
AA seq 425 aa AA seqDB search
MVVEADKKALICSFCSKKQHEVKKLIAGPAVFICDECIDLCTDIMKEENKVALKQITSSI
PTPQKICGILNDYVVGQDQAKKILAVAVYNHYKRLEYIQSGNNDVELNKSNILLIGPTGS
GKTVLAQTLAKILDVPFTMADATSLTEAGYVGEDVENILLRLLIASEFNIAKAQKGIIYI
DEVDKIARKSENPSITRDVSGEGVQQALLKIMEGTVASVPPQGGRKHPQQDFVQLDTSNI
LFICGGAFMGIDSIITSRTNHSSIGFAANVNIDKEKNNSEILKSLEIEDLTKFGLIPEFI
GRLPIVTTLDELDKEALITILTKPKNAIVKQYQKQFELDDAELVIDDSALETIAEKALAK
KTGARGLRSILEHLLLDSMYKVAELKKQRVTITKEVVNGLVEPIMTSLISTKSNKKQPII
ADIPA
NT seq 1278 nt NT seq  +upstreamnt  +downstreamnt
atggtagtagaagctgataaaaaagcattgatttgttcgttttgtagtaaaaaacaacat
gaagtaaaaaaactgatcgcaggtcctgcagtatttatttgtgatgaatgtatagattta
tgtacagatattatgaaagaagaaaataaagttgctttaaagcaaattacttcttcaatt
ccaacgccgcaaaaaatatgtggcattctaaatgattatgtagttgggcaagatcaagcg
aaaaagattttagcagtagcggtttataaccattataagaggcttgaatatatacaatcc
ggcaataatgacgttgagcttaataagtcgaatatcttactgatcggtcctaccggttca
ggaaaaactgtacttgctcaaacgcttgctaaaattttagacgtaccttttactatggcg
gatgctacttccttaacggaagccgggtatgtcggtgaagatgttgagaatatattacta
cgtttattgatagcatctgagtttaatatagcaaaagcacaaaaaggtataatttatatt
gacgaggttgataaaattgcccgtaaatcggagaatccttctattacacgggatgtatcg
ggtgaaggagtacagcaggcattacttaaaattatggaaggaacagttgcttccgtgcct
cctcaaggcggtaggaaacacccacaacaagatttcgtacagttagatacttcaaatatc
ttatttatttgtggtggtgcttttatggggattgatagcattataacctcaagaactaat
catagttctataggctttgcagctaacgtaaatatagataaagagaaaaataatagtgag
attcttaaatccctagagattgaggatttaactaaattcggtttaattcctgaatttatc
ggtagattacctatcgttactactttagatgagttagacaaagaagctttaattacaatt
ttaactaagcctaagaatgccatagtaaagcaatatcagaaacaatttgagcttgatgat
gctgagcttgtaattgatgattcagccttagaaactattgccgaaaaagctctagctaaa
aagacgggagcaagaggactgcgttcaatacttgagcatcttttgcttgatagtatgtat
aaagttgccgagctcaaaaaacagcgtgttactattacaaaagaggtagttaacggctta
gtcgaaccgataatgacctctctcatttctacaaaatcaaacaaaaaacaaccgattatt
gcagatataccggcgtaa

DBGET integrated database retrieval system