KEGG   Rhinopithecus roxellana (golden snub-nosed monkey): 104654060Help
Entry
104654060         CDS       T03989                                 

Gene name
ATG16L1
Definition
(RefSeq) autophagy-related protein 16-1 isoform X4
  KO
K17890  autophagy-related protein 16-1
Organism
rro  Rhinopithecus roxellana (golden snub-nosed monkey)
Pathway
rro04136  Autophagy - other
rro04140  Autophagy - animal
rro04621  NOD-like receptor signaling pathway
Brite
KEGG Orthology (KO) [BR:rro00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    104654060 (ATG16L1)
   04136 Autophagy - other
    104654060 (ATG16L1)
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    104654060 (ATG16L1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:rro04131]
    104654060 (ATG16L1)
   03029 Mitochondrial biogenesis [BR:rro03029]
    104654060 (ATG16L1)
Membrane trafficking [BR:rro04131]
 Autophagy
  Autophagosome formation proteins
   Atg12 conjugation proteins
    104654060 (ATG16L1)
 Others
  Rab GTPases of specific organelles
   Auto phagosome
    104654060 (ATG16L1)
Mitochondrial biogenesis [BR:rro03029]
 Mitochondrial quality control factors
  Mitophagy factors
   Autophagy-related proteins
    104654060 (ATG16L1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ATG16 WD40 ANAPC4_WD40 eIF2A Nup160 ZapB SH3_2 TolB_like SGL
Motif
Other DBs
NCBI-GeneID: 104654060
NCBI-ProteinID: XP_010351441
UniProt: A0A2K6NRV1
Position
14
AA seq 624 aa AA seqDB search
MSSGLRSADFPRWKRHISEELRRRDRLQRQAFEEIILQYNKLLEKSDLHSVLAQKLQAEK
HDVPNRHEISPGHDGTWNDSQLQEMAQLRIKHQEELTELHKKRGELAQLVIDLNNQMQQK
DREMQMNEAKIAECLQTISDLETECLELRTKLCDLERANQTLKDEYDALQITFTALEEKL
RKTTEENQELVTRWMAEKAQEANRLNAENEKDSRRRQARLQKELAEAAKEPLPVEQDDDI
EVIVDETSDHTEETSPVRAISRAATKRLSQPAGGLLDSITNIFGLSESPLLGHHSSSDAA
RRRSVSSFPVPQDNVDTHPGSGKEVRVPTTALCVFDAHDGEVNAVQFSPGSRLLATGGMD
RRVKLWEVFGEKCEFKGSLSGSNAGITSIEFDSAGSYLLAASNDFASRIWTVDDYRLRHT
LTGHSGKVLSAKFLLDNARIVSGSHDRTLKLWDLRSKVCIKTVFAGSSCNDIVCTEQCVM
SGHFDKKIRFWDIRSESIVREMELLGKITALDLNPERTELLSCSRDDLLKVIDLRTNAVK
QTFSAPGFKCGSDWTRVVFSPDGSYVAAGSAEGSLYIWSVLTGKVEKVLSKQHSSSINAV
AWSPSGSHVVSVDKGCKAVLWAQY
NT seq 1875 nt NT seq  +upstreamnt  +downstreamnt
atgtcgtcgggcctccgctccgctgacttcccccgttggaagcggcacatctcggaggaa
ctgaggcgccgggaccggctgcagagacaggcgttcgaggagatcatcctgcagtataac
aaattgctggaaaagtcagatcttcattcagtgttggcccagaaactacaggctgaaaaa
catgacgtaccaaacaggcatgagataagtcccggacatgatggcacatggaatgacagt
cagctacaagaaatggcccagctgaggatcaagcaccaagaagaactgactgaattacac
aagaaacgtggggagttagctcaattggtgattgacctgaataaccaaatgcagcagaag
gacagggagatgcagatgaatgaagcaaagattgcagaatgtttgcagactatctctgac
ctggagacggagtgcctagaactgcgcactaagctttgtgaccttgaaagagccaaccag
accctgaaggatgaatatgatgccctgcagatcacttttactgccttggaggaaaaactg
aggaaaactacggaagagaaccaggagctggtcaccaggtggatggctgagaaagcccag
gaggccaatcggctcaatgcagagaatgaaaaagactccaggaggcggcaagcccggcta
cagaaagagcttgcagaagcagcgaaggaacctctaccagtcgaacaggatgatgacatt
gaggtcattgtggatgaaacctctgatcacacagaagagacgtctcctgtgcgagccatc
agcagagcagccactaagcgactctcgcagcctgctggaggccttctggattctatcact
aatatctttggtctgtccgagtctccccttttgggacatcattcttcttctgatgctgcc
aggagacgctctgtctcttccttcccagtcccccaggacaatgtggatactcatcctggt
tctggtaaagaagtgagggtaccaactacggccttgtgtgtcttcgatgcacatgatggg
gaagtcaacgctgtgcagttcagtccaggttcccggttactggccaccggaggcatggat
cgcagggttaagctttgggaagtatttggagaaaaatgtgagttcaagggttccctatct
ggcagtaatgcaggaattacaagcattgaatttgatagtgctggttcttacctcttagca
gcttcaaatgattttgcaagccgaatctggactgtggatgattatcggttacggcacaca
ctcacgggacatagtgggaaagtgctgtctgctaagttcctgctggacaatgcgcggatc
gtctcaggaagtcacgaccggactctcaaactctgggatctacgcagcaaagtctgcata
aagacagtgtttgcaggatccagttgcaatgatattgtctgcacagagcaatgtgtaatg
agtggacattttgacaagaaaattcgtttctgggacattcgatcagagagtatagttcga
gagatggagctgttgggaaagattactgccctggacttaaacccagaaaggactgagctc
ctgagctgctcccgggatgacttgctaaaagttattgatctccgaacaaatgctgtcaag
cagacattcagtgcacctgggttcaagtgcggctctgactggaccagagttgtcttcagt
cctgacggcagttacgtggcggcaggctctgctgagggctctctctatatctggagtgtg
ctcacggggaaagtggaaaaggttctttcaaagcagcacagctcatccatcaatgcagtg
gcgtggtcgccctctggctcgcacgttgtcagcgtggacaaaggatgcaaagctgtgctg
tgggcacagtattaa

DBGET integrated database retrieval system