KEGG   Rhinopithecus roxellana (golden snub-nosed monkey): 104654547
Entry
104654547         CDS       T03989                                 

Gene name
ERAP1
Definition
(RefSeq) endoplasmic reticulum aminopeptidase 1 isoform X2
  KO
K09604  adipocyte-derived leucine aminopeptidase [EC:3.4.11.-]
Organism
rro  Rhinopithecus roxellana (golden snub-nosed monkey)
Brite
KEGG Orthology (KO) [BR:rro00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:rro01002]
    104654547 (ERAP1)
Enzymes [BR:rro01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.11  Aminopeptidases
    3.4.11.-  
     104654547 (ERAP1)
Peptidases and inhibitors [BR:rro01002]
 Metallo peptidases
  Family M1
   104654547 (ERAP1)
SSDB
Motif
Pfam: Peptidase_M1 ERAP1_C Peptidase_M1_N
Other DBs
NCBI-GeneID: 104654547
NCBI-ProteinID: XP_010352060
UniProt: A0A2K6NID7
Position
3
AA seq 941 aa
MVFPSLKWSLPTMSFLPSLLLALLTVSTPSWCQSSEASPKGSNGMPFPWNKIRLPEYVIP
VHYDLLIHANLTTLTFWGTTEVEITASQPTSTIILHSHHLQISRATLRKGAGERLSEEPL
QVLEHPPQEQIALLAPEPLLVGLLYTVVIHYAGNLSETFHGFYKSTYRTKEGELRILAST
QFEPTAARMAFPCFDEPAFKASFSIKIRREPRHLAISNMPLVKSVTVAEGLIEDHFDVTV
KMSTYLVAFIISDFESVSKITKSGVKVSVYAVPDKINQADYALDAAVTLLDFYEDYFNIP
YPLPKQDLAAIPDFQSGAMENWGLTTYRESALLFDAEKSPASSKLGITMIVAHELAHQWF
GNLVTMEWWSDLWLNEGFAKFMEFVSVSVTHPELKVEDYFFGKCFDAMEVDALNSSHPVS
TPVENPAQIREMFDDVSYDKGACILNMLREYLSADAFKSGIVQYLQKHSYKNTKNEDLWD
SMASICPTDGVKGMDGFCSGSQHSSSFSHWHQEGLDVKTMMNTWTLQKGFPLITITVRGR
NVHMKQEHYMKGSEGAPDTGYLWHVPLTFITSKSDMVHRFLLKTKIDVLILPEEVEWIKF
NVGMNGYYIVHYEDDGWDSLTGLLKGTHTAVSSNDRASLINNAFQLVSIGKLSIEKALDL
SLYLKHETEIMPVFQGLNELIPMYKLMEKRDMNEVETQFKAFLIRLLRDLIDKQTWTDEG
SVSERMLRSQLLLLACVRKYQPCVQRAEGYFRKWKESNGNLSLPIDVTLAVFAVGAQSTE
GWDFLYSKYQSSLSSTEKKQIEFALCTTQNKEKLQWLLDESFKGDKIKTQEFPEVLVLIG
RNPVGYPLAWKFLRKNWNKLVQKFELGSRSIAHMVMGTTNQFSTRTWLEEVKGFFSSLKE
NGSQLRCVQQTIETIEENICWMDKNFDKIRVWLQSEKFELL
NT seq 2826 nt   +upstreamnt  +downstreamnt
atggtgtttccgtccctcaaatggtcccttccaaccatgtcatttctaccttccttactg
ttggctctcttaactgtgtccactccttcatggtgtcagagcagtgaagcatctccaaaa
ggtagtaatgggatgccatttccttggaataaaataagacttcctgagtatgtcatccca
gttcattatgatctcctgatccatgcaaaccttaccacgctgaccttctggggaaccaca
gaagtagaaataacagccagtcagcccaccagcaccatcatcctgcatagtcaccacctg
cagatatctagggccaccctcaggaaaggagctggagagaggctatcggaagaaccgctt
caggtcctggaacaccctcctcaggagcaaatcgcgctgctggctcctgagcccctcctt
gtcgggctcctgtacacagttgtcattcactatgctggcaatctttcggagactttccac
ggattttacaaaagcacctacagaaccaaggaaggggaactgaggatacttgcatcaaca
caatttgaacccactgcagctagaatggcctttccatgttttgatgaacctgccttcaaa
gcaagtttctcaatcaaaattcgaagagagccaaggcacctagccatctccaatatgcca
ctggtgaaatctgtgactgttgctgaaggactcatagaagaccattttgatgtcactgtg
aagatgagtacctatctagtggccttcattatttcagattttgagtctgtcagcaagata
accaagagtggagtcaaggtttctgtatatgctgtgccagacaagataaatcaagcagat
tatgcactggatgctgcggtgactcttctagatttttatgaggattatttcaacataccg
tatcccctacccaaacaagatcttgctgctattcccgactttcaatctggtgctatggaa
aactggggactaacaacatatagagaatctgctctattgtttgatgcggaaaagtctcct
gcatcaagtaagcttggcatcacaatgattgtggcccatgaactggcccaccagtggttt
gggaacctggtcactatggaatggtggagtgatctttggctaaatgagggatttgccaaa
tttatggagtttgtgtctgtcagtgtgacccatcctgaactgaaagttgaagattatttc
tttggcaaatgttttgatgcaatggaggtagatgctttaaattcctcacaccctgtgtct
acacctgtggagaatcctgctcagatccgggagatgtttgatgatgtttcttatgataag
ggagcttgtattctgaatatgctaagggagtatcttagtgctgatgcatttaaaagtggt
attgtacagtatctccagaagcatagctataaaaatacaaaaaacgaggacctgtgggat
agtatggcaagtatttgccctacagacggtgtaaaagggatggatggcttttgctctgga
agtcaacattcatcttcattctcacattggcatcaggaaggactggatgtgaaaaccatg
atgaacacttggacactgcagaagggttttcccctgataaccatcacagtgagggggagg
aatgtacacatgaagcaagagcactacatgaagggctctgaaggcgccccggacactggg
tacctgtggcatgttccattgacgttcatcaccagcaaatcagacatggtccatcgattt
ttgctaaaaacaaaaatagatgtgctcatcctcccagaagaggtggaatggatcaaattt
aatgtgggcatgaatggctattacattgtgcattacgaggatgatggatgggactctttg
actggccttttaaaaggaacacacacagcagtcagcagtaatgatcgggcgagtctcatt
aacaatgcatttcagctcgtcagcattgggaagctgtccattgaaaaggccttggattta
tccctgtacttgaaacatgaaactgaaattatgcccgtatttcaaggtttgaatgagctg
attcctatgtataagttaatggagaaaagagatatgaatgaagtggaaactcaattcaag
gccttcctcatcaggctactaagggacctcattgataagcagacgtggacagacgaaggc
tcggtctcagagcgaatgctgcggagtcagctactcctcctcgcctgtgtgcgcaagtat
cagccgtgtgtacagagggcagaaggctatttcaggaagtggaaggaatccaatggaaac
ttgagcctgcctatcgatgtgaccttggcagtgtttgctgtgggggcccagagcacagaa
ggctgggattttctttatagtaaatatcagtcttctttgtccagtactgagaaaaaacaa
attgaatttgccctctgcacaacccaaaataaggaaaagcttcaatggctactagatgaa
agctttaagggagataaaataaaaactcaggagtttccagaagttcttgtactcattggc
aggaacccagtaggatacccactggcctggaaatttctgaggaaaaactggaacaaactt
gtacagaagtttgaacttggctcacgttccatagcccacatggtaatgggtacaacaaat
caattctccacaagaacatggcttgaagaggtaaaaggattcttcagctctttaaaagaa
aatggttctcagctccgttgtgtccaacagacaattgaaaccattgaagaaaacatctgt
tggatggataagaattttgataaaatcagagtgtggctgcaaagtgaaaagtttgaactt
ctgtaa

DBGET integrated database retrieval system