KEGG   Rhinopithecus roxellana (golden snub-nosed monkey): 104655370
Entry
104655370         CDS       T03989                                 

Gene name
APLN
Definition
(RefSeq) apelin
  KO
K05225  apelin
Organism
rro  Rhinopithecus roxellana (golden snub-nosed monkey)
Pathway
rro04080  Neuroactive ligand-receptor interaction
rro04371  Apelin signaling pathway
Brite
KEGG Orthology (KO) [BR:rro00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    104655370 (APLN)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    104655370 (APLN)
SSDB
Motif
Pfam: Apelin
Other DBs
NCBI-GeneID: 104655370
NCBI-ProteinID: XP_010353090
UniProt: A0A2K6RR72
Position
7
AA seq 77 aa
MNLRLCVQALLLLWLSLTAVCGGPLMRLPYGNGLEEGNVRHLVQPRGSRNGPGPWQGGRR
KFRRQRPRLSHKGPMPF
NT seq 234 nt   +upstreamnt  +downstreamnt
atgaatctgcggctctgcgtgcaggctctcctgctcctctggctctccttgaccgcagtg
tgtggagggcccctgatgcggcttccctatgggaatgggctggaagagggcaatgtccgc
cacctggtgcagcccagagggtcgaggaacgggccagggccctggcagggaggtcggagg
aaattccgccgccagcggccccgcctctcccataagggacccatgcctttctga

DBGET integrated database retrieval system