KEGG   Rhinopithecus roxellana (golden snub-nosed monkey): 104656944Help
Entry
104656944         CDS       T03989                                 

Gene name
MGLL
Definition
(RefSeq) monoglyceride lipase
  KO
K01054  acylglycerol lipase [EC:3.1.1.23]
Organism
rro  Rhinopithecus roxellana (golden snub-nosed monkey)
Pathway
rro00561  Glycerolipid metabolism
rro01100  Metabolic pathways
rro04714  Thermogenesis
rro04723  Retrograde endocannabinoid signaling
rro04923  Regulation of lipolysis in adipocytes
Module
rro_M00098  Acylglycerol degradation
Brite
KEGG Orthology (KO) [BR:rro00001]
 09100 Metabolism
  09103 Lipid metabolism
   00561 Glycerolipid metabolism
    104656944 (MGLL)
 09150 Organismal Systems
  09152 Endocrine system
   04923 Regulation of lipolysis in adipocyte
    104656944 (MGLL)
  09156 Nervous system
   04723 Retrograde endocannabinoid signaling
    104656944 (MGLL)
  09159 Environmental adaptation
   04714 Thermogenesis
    104656944 (MGLL)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:rro01002]
    104656944 (MGLL)
Enzymes [BR:rro01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.23  acylglycerol lipase
     104656944 (MGLL)
Peptidases [BR:rro01002]
 Serine Peptidases
  Family S33
   104656944 (MGLL)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hydrolase_4 Abhydrolase_6 Abhydrolase_1 Esterase Lipase_3 Abhydrolase_3 DLH PGAP1 Thioesterase Abhydrolase_5 LIDHydrolase Abhydrolase_2 DUF1350 DUF1057 DUF2974
Motif
Other DBs
NCBI-GeneID: 104656944
NCBI-ProteinID: XP_010354950
UniProt: A0A2K6RC46
Position
Un
AA seq 339 aa AA seqDB search
METGSEDPSRMPEESSPRRTPQSIPYQDLPHLVNADGQYLFCRYWKPTGTPKALIFVSHG
AGEHCGRYEELAQMLMGLDLLVFAHDHVGHGQSEGERMVVSDFHVFVRDVLQHVDSMQKD
YPGLPVFLLGHSMGGAIAILTAAERPGHFAGMVLISPLVLANPESATTFKDYSGILKHSM
EKASRTLQFWIPSPFWVLAAKVLNLVLPNLSLGPIDSSVLSRNKTEVDIYNSDPLICRAG
LKVCFGIQLLNAVSRVERALPKLTVPFLLLQGSADRLCDSKGAYLLMESAKSQDKTLKIY
EGAYHVLHKELPEVTNSVFHEINMWVSQRTATAGTASPP
NT seq 1020 nt NT seq  +upstreamnt  +downstreamnt
atggaaacaggatctgaagacccttccagaatgccagaggaaagttcccccaggcggacc
ccgcagagcattccctaccaggatctccctcacttggtcaatgcagacggacagtacctc
ttctgcaggtactggaaacccacgggcacacccaaggccctcatctttgtgtcccacgga
gccggagagcactgtggccgctatgaagagctggctcagatgctgatggggctggacctg
ctggtgttcgcccacgaccatgttggccacggacagagcgaaggggagaggatggtagtg
tctgacttccacgtttttgtcagagatgtgttgcagcatgtggattccatgcagaaagac
taccctgggcttcctgtcttccttctgggccactccatgggaggtgccatcgccatcctc
acggccgcagagaggccgggtcacttcgccggcatggtactcatttcacctctggttctt
gccaatcctgaatctgcaacaactttcaaggattattcggggattttgaaacactcgatg
gaaaaggcatcaagaacgttacagttttggattccaagtcctttttgggtccttgctgcg
aaagtgctcaaccttgtgctgccaaacttgtccctcgggcccatcgactccagcgtgctc
tctcggaataagacagaggtcgacatttataactcagaccccttgatctgccgggcaggg
ctgaaggtgtgctttggcatccagctgctgaatgccgtctcacgggtggagcgcgccctc
cccaagctgacggtgcccttcctgctgctccagggctctgctgatcgcctgtgtgacagc
aaaggggcctacctgctcatggagtcagccaagagccaggacaagactctcaagatttat
gaaggtgcctaccacgttctccacaaagagcttcctgaagtcaccaactctgtcttccat
gaaataaacatgtgggtctctcaaaggacagccacggcaggaactgcgtccccaccctga

DBGET integrated database retrieval system