KEGG   Rhinopithecus roxellana (golden snub-nosed monkey): 104660585Help
Entry
104660585         CDS       T03989                                 

Gene name
UXS1
Definition
(RefSeq) UDP-glucuronate decarboxylase 1
  KO
K08678  UDP-glucuronate decarboxylase [EC:4.1.1.35]
Organism
rro  Rhinopithecus roxellana (golden snub-nosed monkey)
Pathway
rro00520  Amino sugar and nucleotide sugar metabolism
rro01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:rro00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    104660585 (UXS1)
Enzymes [BR:rro01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.35  UDP-glucuronate decarboxylase
     104660585 (UXS1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GDP_Man_Dehyd Epimerase UXS1_N NAD_binding_4 RmlD_sub_bind 3Beta_HSD Polysacc_synt_2
Motif
Other DBs
NCBI-GeneID: 104660585
NCBI-ProteinID: XP_010359292
Position
Un
AA seq 425 aa AA seqDB search
MVSKALLRLVSAVNRRRMKLLLGIALLAYVASVWGNFVNMSFLLNRSIQENGELKIESKI
EEMVEPLREKIRDLEKSFTQKYPPVKFLSEKDRKRILITGGAGFVGSHLTDKLMMDGHEV
TVVDNFFTGRKRNVEHWIGHENFELINHDVVEPLYIEVDQIYHLASPASPPNYMYNPIKT
LKTNTIGTLNMLGLAKRVGARLLLASTSEVYGDPEVHPQSEDYWGHVNPIGPRACYDEGK
RVAETMCYAYMKQEGVEVRVARIFNTFGPRMHMNDGRVVSNFILQALQGEPLTVYGSGSQ
TRAFQYVSDLVNGLVALMNSNVSSPVNLGNPEEHTILEFAQLIKNLVGSGSEIQFLSEAQ
DDPQKRKPDIKKAKLMLGWEPVVPLEEGLNKAIHYFRKELEYQANNQYIPKPKPARIKKG
RTRHN
NT seq 1278 nt NT seq  +upstreamnt  +downstreamnt
atggtgagcaaggcgctgctgcgcctcgtgtctgccgtcaaccgcaggaggatgaagctg
ctgctgggcatcgccttgctggcctacgtcgcctctgtttggggcaacttcgttaatatg
agctttctactcaacaggtctatccaggaaaatggtgaactaaaaattgaaagcaagatt
gaagagatggttgaaccactaagagagaaaatcagagatttagaaaaaagctttacccag
aaatacccaccagtaaagtttttatcagaaaaggatcggaaaagaattttgataaccgga
ggcgcagggttcgtgggctcccatctaactgacaaactcatgatggacggccacgaggtg
accgtggtggacaatttcttcacgggcaggaagagaaacgtggagcactggatcggacat
gagaacttcgagctgattaaccacgacgtggtagagcccctctacatcgaggttgaccag
atataccatctggcatctccagcctcccctccaaactacatgtataatcctatcaagaca
ttaaagaccaatacgattgggacattaaacatgttggggctggcaaaacgagtcggcgcc
cgtctgctcctggcctccacatcggaggtgtatggagatcctgaagtccaccctcaaagt
gaggattactggggccacgtgaatccaataggacctcgggcctgctatgatgaaggcaaa
cgtgtcgcagagaccatgtgctatgcctacatgaagcaggaaggcgtggaagtacgagtg
gccagaatcttcaacacctttggaccacgcatgcacatgaatgatgggcgggtggtcagc
aacttcatcctgcaggcgctccagggggagccgctcacggtatacggatccgggtctcag
acaagggcgttccagtacgtcagtgatctggtgaatggcctcgtggctctcatgaacagc
aatgtcagcagcccagtcaacctggggaacccagaagaacacacaatcctagaatttgct
cagttaattaaaaaccttgttggtagcggaagtgaaattcagtttctctccgaagcccag
gatgacccacagaaaagaaaaccagacatcaaaaaagcaaagctgatgctggggtgggag
cccgtggtcccgctggaggaaggcttaaacaaagcaattcactacttccgtaaagaactc
gagtaccaggcaaataatcagtacatccccaaaccaaagcctgccagaataaagaaggga
cggactcgccacaactga

DBGET integrated database retrieval system