KEGG   Rhinopithecus roxellana (golden snub-nosed monkey): 104661913
Entry
104661913         CDS       T03989                                 

Gene name
TNF
Definition
(RefSeq) tumor necrosis factor isoform X1
  KO
K03156  tumor necrosis factor superfamily, member 2
Organism
rro  Rhinopithecus roxellana (golden snub-nosed monkey)
Pathway
rro01523  Antifolate resistance
rro04010  MAPK signaling pathway
rro04060  Cytokine-cytokine receptor interaction
rro04061  Viral protein interaction with cytokine and cytokine receptor
rro04064  NF-kappa B signaling pathway
rro04071  Sphingolipid signaling pathway
rro04150  mTOR signaling pathway
rro04210  Apoptosis
rro04217  Necroptosis
rro04350  TGF-beta signaling pathway
rro04380  Osteoclast differentiation
rro04612  Antigen processing and presentation
rro04620  Toll-like receptor signaling pathway
rro04621  NOD-like receptor signaling pathway
rro04622  RIG-I-like receptor signaling pathway
rro04625  C-type lectin receptor signaling pathway
rro04640  Hematopoietic cell lineage
rro04650  Natural killer cell mediated cytotoxicity
rro04657  IL-17 signaling pathway
rro04660  T cell receptor signaling pathway
rro04664  Fc epsilon RI signaling pathway
rro04668  TNF signaling pathway
rro04920  Adipocytokine signaling pathway
rro04930  Type II diabetes mellitus
rro04931  Insulin resistance
rro04932  Non-alcoholic fatty liver disease
rro04933  AGE-RAGE signaling pathway in diabetic complications
rro04940  Type I diabetes mellitus
rro05010  Alzheimer disease
rro05014  Amyotrophic lateral sclerosis
rro05132  Salmonella infection
rro05133  Pertussis
rro05134  Legionellosis
rro05135  Yersinia infection
rro05140  Leishmaniasis
rro05142  Chagas disease
rro05143  African trypanosomiasis
rro05144  Malaria
rro05145  Toxoplasmosis
rro05146  Amoebiasis
rro05152  Tuberculosis
rro05160  Hepatitis C
rro05161  Hepatitis B
rro05163  Human cytomegalovirus infection
rro05164  Influenza A
rro05165  Human papillomavirus infection
rro05166  Human T-cell leukemia virus 1 infection
rro05168  Herpes simplex virus 1 infection
rro05169  Epstein-Barr virus infection
rro05170  Human immunodeficiency virus 1 infection
rro05205  Proteoglycans in cancer
rro05310  Asthma
rro05321  Inflammatory bowel disease
rro05322  Systemic lupus erythematosus
rro05323  Rheumatoid arthritis
rro05330  Allograft rejection
rro05332  Graft-versus-host disease
rro05410  Hypertrophic cardiomyopathy
rro05414  Dilated cardiomyopathy
rro05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:rro00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    104661913 (TNF)
   04350 TGF-beta signaling pathway
    104661913 (TNF)
   04064 NF-kappa B signaling pathway
    104661913 (TNF)
   04668 TNF signaling pathway
    104661913 (TNF)
   04071 Sphingolipid signaling pathway
    104661913 (TNF)
   04150 mTOR signaling pathway
    104661913 (TNF)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    104661913 (TNF)
   04061 Viral protein interaction with cytokine and cytokine receptor
    104661913 (TNF)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    104661913 (TNF)
   04217 Necroptosis
    104661913 (TNF)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    104661913 (TNF)
   04620 Toll-like receptor signaling pathway
    104661913 (TNF)
   04621 NOD-like receptor signaling pathway
    104661913 (TNF)
   04622 RIG-I-like receptor signaling pathway
    104661913 (TNF)
   04625 C-type lectin receptor signaling pathway
    104661913 (TNF)
   04650 Natural killer cell mediated cytotoxicity
    104661913 (TNF)
   04612 Antigen processing and presentation
    104661913 (TNF)
   04660 T cell receptor signaling pathway
    104661913 (TNF)
   04657 IL-17 signaling pathway
    104661913 (TNF)
   04664 Fc epsilon RI signaling pathway
    104661913 (TNF)
  09152 Endocrine system
   04920 Adipocytokine signaling pathway
    104661913 (TNF)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    104661913 (TNF)
 09160 Human Diseases
  09161 Cancer: overview
   05205 Proteoglycans in cancer
    104661913 (TNF)
  09163 Immune disease
   05310 Asthma
    104661913 (TNF)
   05322 Systemic lupus erythematosus
    104661913 (TNF)
   05323 Rheumatoid arthritis
    104661913 (TNF)
   05321 Inflammatory bowel disease
    104661913 (TNF)
   05330 Allograft rejection
    104661913 (TNF)
   05332 Graft-versus-host disease
    104661913 (TNF)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    104661913 (TNF)
   05014 Amyotrophic lateral sclerosis
    104661913 (TNF)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    104661913 (TNF)
   05410 Hypertrophic cardiomyopathy
    104661913 (TNF)
   05414 Dilated cardiomyopathy
    104661913 (TNF)
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    104661913 (TNF)
   04940 Type I diabetes mellitus
    104661913 (TNF)
   04932 Non-alcoholic fatty liver disease
    104661913 (TNF)
   04931 Insulin resistance
    104661913 (TNF)
   04933 AGE-RAGE signaling pathway in diabetic complications
    104661913 (TNF)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    104661913 (TNF)
   05135 Yersinia infection
    104661913 (TNF)
   05133 Pertussis
    104661913 (TNF)
   05134 Legionellosis
    104661913 (TNF)
   05152 Tuberculosis
    104661913 (TNF)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    104661913 (TNF)
   05170 Human immunodeficiency virus 1 infection
    104661913 (TNF)
   05164 Influenza A
    104661913 (TNF)
   05161 Hepatitis B
    104661913 (TNF)
   05160 Hepatitis C
    104661913 (TNF)
   05168 Herpes simplex virus 1 infection
    104661913 (TNF)
   05163 Human cytomegalovirus infection
    104661913 (TNF)
   05169 Epstein-Barr virus infection
    104661913 (TNF)
   05165 Human papillomavirus infection
    104661913 (TNF)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    104661913 (TNF)
   05144 Malaria
    104661913 (TNF)
   05145 Toxoplasmosis
    104661913 (TNF)
   05140 Leishmaniasis
    104661913 (TNF)
   05142 Chagas disease
    104661913 (TNF)
   05143 African trypanosomiasis
    104661913 (TNF)
  09176 Drug resistance: antineoplastic
   01523 Antifolate resistance
    104661913 (TNF)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:rro04052]
    104661913 (TNF)
   00536 Glycosaminoglycan binding proteins [BR:rro00536]
    104661913 (TNF)
Cytokines and growth factors [BR:rro04052]
 Cytokines
  Tumor necrosis fators
   104661913 (TNF)
Glycosaminoglycan binding proteins [BR:rro00536]
 Heparan sulfate / Haparin
  Cytokines
   104661913 (TNF)
SSDB
Motif
Pfam: TNF
Other DBs
NCBI-GeneID: 104661913
NCBI-ProteinID: XP_010361054
Position
4
AA seq 234 aa
MSTESMIRDVELAEEALPRKTAGPQGSRRCWFLSLFSFLLVAGATTLFCLLHFGVIGPQR
EEQFPKDLPLISPLAQAVRSSSRTPSDKPVAHVVANPQAEGQLQWLNRRANALLANGVEL
TDNQLVVPSEGLYLIYSQVLFKGQGCPSNHVLLTHTISRIAVSYQTKVNLLSAIKSPCQR
ETPEGAEAKPWYEPIYLGGVFQLEKGDRLSAEINLPDYLDFAESGQVYFGIIAL
NT seq 705 nt   +upstreamnt  +downstreamnt
atgagcacggaaagcatgatccgggacgtggagctggccgaggaggcactccccaggaag
acagcggggccccagggctccaggcggtgctggtttctcagcctcttctccttcctgctc
gtggcaggcgccaccacgctcttctgtctgctgcactttggagtgatcggcccccagagg
gaagagcagttccccaaggacctccctctaatcagccctctggcccaggcagtcagatca
tcttctcgaaccccaagtgacaagcctgtagcccatgttgtagcaaatcctcaagctgag
gggcagctccagtggctgaaccgccgggccaatgccctcctggccaatggcgtagagctg
acagataaccagctggtggtgccatcagagggcctgtacctcatctactcccaggtcctc
ttcaagggccaaggctgcccctccaaccatgtgctcctcacccacaccatcagccgcatc
gccgtctcctaccagaccaaggtcaacctcctctctgccatcaagagcccctgccagagg
gagactccagagggggctgaggccaagccctggtatgagcccatctacctaggaggggtc
ttccagctggagaagggtgatcgactcagcgctgagatcaatctgcccgactatctcgac
tttgccgagtctgggcaggtctactttgggatcattgccctgtga

DBGET integrated database retrieval system