KEGG   Rhinopithecus roxellana (golden snub-nosed monkey): 104662679Help
Entry
104662679         CDS       T03989                                 

Gene name
LTB4R
Definition
(RefSeq) leukotriene B4 receptor 1
  KO
K04296  leukotriene B4 receptor 1
Organism
rro  Rhinopithecus roxellana (golden snub-nosed monkey)
Pathway
rro04080  Neuroactive ligand-receptor interaction
Brite
KEGG Orthology (KO) [BR:rro00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    104662679 (LTB4R)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:rro04030]
    104662679 (LTB4R)
G protein-coupled receptors [BR:rro04030]
 Rhodopsin family
  Lipid
   Leukotriene
    104662679 (LTB4R)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 7tm_1 7TM_GPCR_Srsx 7TM_GPCR_Srx 7tm_4
Motif
Other DBs
NCBI-GeneID: 104662679
NCBI-ProteinID: XP_010362030
Position
5
AA seq 348 aa AA seqDB search
MNTTSAAPPSLANFLLAIILLSVALAVGLPGNSFVVWSILKRMKKRSVTALLVLNLALAD
LAVLLTAPFFLHFLAQGTWSFGLAGCRLCHYVCGVSMYASVLLITAMSLDRSLAVALPFV
SQKLRTKAMALRVLAGIWVVSFLLATPVLVYRTVVASKTNMSLCSPKYPSKKHQAFHLIF
EAVTGFLLPFLAVVASYSDIGRRLQARRFRRSRRTGRLVVLIILAFAAFWLPYHVVNLAE
AARALAGQASGSGLVGQRLALARKVLIALAFLSSSVNPVLYACAGGGLLRSAGVGFVAKL
LEGTGSEASSTRRGGSLGQTVRGGPAAQEPGPSESLTASSPLELNELN
NT seq 1047 nt NT seq  +upstreamnt  +downstreamnt
atgaacactacatctgcagcacccccctcactagccaactttctgttggctatcatcctg
ctgtcagtggcgctggctgtggggcttcccggcaacagctttgtggtgtggagcatcttg
aaaaggatgaagaagcgctctgtcactgccctgttggtgctgaacctggccctggccgac
ctggccgtattgctcactgctccctttttccttcacttcctggcccaaggcacctggagt
tttggattggctggttgtcgcctgtgccactatgtctgtggagtcagcatgtacgccagt
gtcctgcttatcacagccatgagtctagaccgctcactggcagtggccctcccctttgtg
tcccagaagctacgcaccaaggcgatggccctgcgggtgctggcaggcatctgggtggtg
tcctttctgctggccacacccgtcctcgtgtaccgcacagtagtggcctcgaaaacgaac
atgagcctgtgttctccgaagtaccccagcaagaagcaccaggccttccatctaatcttt
gaggccgtcacgggcttcctgctgcccttcctggctgtggtggccagctactccgacata
gggcgtcggctgcaggcccggcgcttccgccgcagccgccgcactggtcgcctggtggtg
ctcatcatcctggccttcgccgccttctggctgccctaccacgtggtgaacctggccgaa
gccgcccgtgcgctggccggccaggcctccgggtcggggctcgtggggcagcggctggca
ctggcccgcaaggtactcatcgcgctcgccttcctgagcagcagtgtgaaccccgtgctg
tacgcctgcgccggcggcggcctgctacgctcagcgggcgtgggcttcgtcgccaagctg
ctggagggcacgggctccgaggcgtccagtacccgccgcgggggcagcctgggccagacc
gtgaggggcggccccgccgctcaggagcctggcccttccgagagcctcactgcctccagc
cctctcgagttaaacgaactgaactag

DBGET integrated database retrieval system