KEGG   Rhinopithecus roxellana (golden snub-nosed monkey): 104662692Help
Entry
104662692         CDS       T03989                                 

Gene name
IPO4
Definition
(RefSeq) importin 4
  KO
K20221  importin-4
Organism
rro  Rhinopithecus roxellana (golden snub-nosed monkey)
Brite
KEGG Orthology (KO) [BR:rro00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03009 Ribosome biogenesis [BR:rro03009]
    104662692 (IPO4)
Ribosome biogenesis [BR:rro03009]
 Eukaryotic Type
  Pre-40S particles
   Export and cytoplasmic maturation factors
    104662692 (IPO4)
  Pre-60S particles
    104662692 (IPO4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: HEAT_2 HEAT HEAT_EZ IBN_N UME RIX1 DUF3385 Cnd1 Adaptin_N Cohesin_HEAT
Motif
Other DBs
NCBI-GeneID: 104662692
NCBI-ProteinID: XP_010362072
UniProt: A0A2K6NF34
Position
Un
AA seq 1081 aa AA seqDB search
MEPAGLEQLLRELLLPDTERIRRATEQLQIALRAPAALPALCDLLASAADPQIRQFAALL
TRRRLNTRWRRLAAEQRESLKSLILTALQRETEHCVSLSLAQLSATIFRKEGLEAWPQLL
QLLQHSTHSPHSPEREMGLLLLSVVVTSQPEAFQPHHRELLRLLNETLGEVGSPGLLFYS
LRTLTAMAPYLSTEDVPLARMLVPKLIVAVQTLIPIDEAKACEALEVLDELLESEVPIIT
PNLSEVLTFCLEVARNVALGNAIRVRILCCLTFLVKVKSKALLKNRLLPPLLHTLFPIMA
AEPLPGQLDPEDQDSEEEELEIELMGETPKHFAVQVVDMLALHLPPDKLCPQLMPMLEEA
LRSESPYQRKAGLLVLAVLSDGAGDHIRQRLLPPLLQIVCKGLEDPSQVVRNAALFALGQ
FSENLQPHISSYSREVMPLLLAYLKSVPLGHTHHLAKACYALENFVENLGPKVQPYLPEL
MECMLQPLRNPSSPRAKELAVSALGAIATAAQASLLPYFPAIMEHLREFLLTGREDLQPV
QIQSLETLGVLARAVGEPMRPLAEECCQLGLGLCNQVDDPDLRRCTYSLFAALSGLMGEG
LAPHLEQITMLMLLSLRSTEGIVPQCDGSSSFLLFDDESDGEEEEELMDEDVEEEDDSEI
SGYSVENAFFDEKEDTCAALGEISVNTSVAFLPYMESVFEEVFKLLECPHLNVRKAAHEA
LGQFCCALHKACQSCPSEPNTAALQAALARVVPSYVQAVNRERERQVVMAVLEALTGVLR
SCGTLTLKPPGRLAELCSMLKAVLQRKTACQNADEEEEEEDDDQAEYDAMLLEHAGEAIP
ALAAAAGGDSFAPFFAGFLPLLVCKTKQGCTVAEKSFAVGTLAETIQGLGAASAQFVSRL
LPVLLSTAREADPEVRSNAIFGMGVLAEHGGHPAQEHFPKLLGLLFPLLARERHDRVRDN
ICGALARLLMASPTRKPEPQVLAALLHALPLKKDLEEWVTIGRLFSFLYQSSPDQVIDVA
PELLRICSLIMADNNIPPDTKAALLLLLTFLAEQHADSFQAALGSLPVDKAQELQAVLGL
S
NT seq 3246 nt NT seq  +upstreamnt  +downstreamnt
atggagcccgccggcctggagcagctcctacgggagctgctgctgccggacaccgaacgc
atccgtcgggccacggaacagctccagatcgctcttcgggcccccgccgctttgccggct
ctctgcgacctgcttgcctcggcggccgacccccagatccgccagtttgcggccctgctg
acccgcagacgactgaacacccgctggcgacggctggcggcggagcaacgggagagcctc
aagtccctgatcctgacggccctgcagagagaaacagagcactgtgtgagcctcagcctg
gcccagctttcagccaccatttttcgaaaggaaggcctggaggcctggccacagcttttg
cagcttcttcagcacagtacccacagcccccacagcccagagagagagatggggcttttg
ctgctaagtgtggtggtgacctcccagcccgaggccttccaaccccaccaccgggagctt
cttcggcttctgaatgagactcttggtgaggtgggctctcctgggctgctcttctactcc
ctgcgcactctgaccgccatggccccctacctcagcactgaagacgtgcctctcgctcgg
atgttggtgcccaagctgatcgtggctgtgcagactctgatccccatagatgaggcaaag
gcctgtgaggcccttgaggttttggatgaactgttggagtcagaggtgcccatcatcacc
cccaacctctctgaggtcctcacattctgcctggaggtggctagaaatgtggccctgggc
aatgcgatacgcgtacgtattctctgctgcctcactttcttggtcaaagtcaagagcaag
gccttactgaagaatcgtctcctaccacccttgctgcacacccttttccccattatggct
gctgagcccctgccaggccagttggatcctgaggaccaggattcagaagaggaagagttg
gagattgagctgatgggggagactcccaagcattttgctgtacaggttgtggacatgctg
gcgctacacctgccccccgacaagctctgtccccagctgatgcccatgctggaagaggcc
ttgcggagcgagagcccataccagcgcaaggctggactcctggtgctggccgtgctgtct
gacggagctggtgaccacatcaggcagagactgctgcccccactgctgcagatcgtgtgc
aagggcctggaggacccctcgcaagttgtacgcaatgctgcgctatttgccctgggccag
ttctcagaaaacctacagccccatatcagcagctattcaagggaggtaatgccactgctc
ctcgcctacctgaagtcggtgcctcttggacacacacaccacctagccaaggcctgctat
gccctggagaatttcgtggagaacctagggcccaaggtgcagccctaccttccggagctt
atggaatgcatgctgcagcctctgaggaaccccagcagtccccgggccaaggagctggct
gtgagcgccctgggagccattgctacagctgcccaggcctcactgctgccctacttccct
gccatcatggagcacctgcgggaatttctgttaacaggccgtgaggaccttcaacctgtg
cagatccagagcctggagacactgggagtgctggcacgagcggtgggggagcccatgagg
ccgctggctgaggaatgctgccagctgggtctgggcctctgcaaccaggtagacgaccct
gacttgcggcgctgcacgtacagcctatttgccgccttatcgggtctgatgggcgagggc
ttggcaccccacttggaacagatcaccatgctcatgctgctgtcactgcgttctaccgag
ggcattgtgcctcagtgtgacgggagcagctccttccttctgtttgacgatgagagtgat
ggggaagaagaggaggagctcatggatgaggatgtggaagaagaggatgactcagagatc
tcagggtacagcgtggagaacgccttctttgatgagaaggaagacacctgtgctgcccta
ggggagatctctgtgaacaccagtgtggccttccttccatacatggaaagtgtctttgaa
gaagtatttaaactgctggagtgccctcacctgaatgtgcggaaggcagcccatgaggct
ctgggtcagttttgctgtgcactgcacaaggcctgtcaaagctgcccctcggaacccaac
actgctgctttgcaggctgccctggcccgagtggtgccatcctacgtgcaggcagtgaac
agggagcgggagcgccaggtggtgatggccgtgctggaggccctgacaggggtgctccgc
agctgtgggaccctcactctgaagccccctgggcgcctggctgagctctgtagcatgctc
aaggctgtgctgcagaggaagacagcctgtcagaatgctgatgaggaggaggaagaggaa
gatgatgatcaggctgaatacgatgccatgttgctggagcacgctggagaggccatccct
gccctggcagccgcggctgggggagactcctttgccccattctttgctggtttcctgcca
ttattggtgtgcaagacaaagcagggctgcacagtggcagagaagtcctttgcagtgggg
accttggcagagactattcagggcctgggtgccgcctcagcccaatttgtgtctcggctg
ctccctgtgctgttgagcaccgcccgagaggcagaccctgaggtgcgaagcaatgccatc
tttgggatgggcgtgctggcagagcacgggggccaccctgcccaggaacacttccccaag
ttgctggggctccttttccccctcctggcgcgggagagacacgatcgtgtccgtgacaac
atctgtggggcacttgcccgcctgttgatggccagtcccaccaggaaaccagagccccag
gtgctggctgccctactgcatgccctgccactgaagaaggacttggaggagtgggtcacc
attgggcgcctcttcagcttcctgtaccagagcagccctgaccaggttatagatgtggct
ccagagctcttgcgtatctgcagcctcattatggctgacaacaatatcccaccagacacc
aaggccgcactgttgctgctcctgacattcctggccgaacagcacgctgacagcttccag
gcagctctgggctcactgcctgttgacaaggctcaggagctccaggctgtgctgggcctc
tcctag

DBGET integrated database retrieval system