KEGG   Rhinopithecus roxellana (golden snub-nosed monkey): 104662828
Entry
104662828         CDS       T03989                                 

Gene name
TM7SF2
Definition
(RefSeq) delta(14)-sterol reductase TM7SF2 isoform X1
  KO
K00222  Delta14-sterol reductase [EC:1.3.1.70]
Organism
rro  Rhinopithecus roxellana (golden snub-nosed monkey)
Pathway
rro00100  Steroid biosynthesis
rro01100  Metabolic pathways
Module
rro_M00101  Cholesterol biosynthesis, squalene 2,3-epoxide => cholesterol
Brite
KEGG Orthology (KO) [BR:rro00001]
 09100 Metabolism
  09103 Lipid metabolism
   00100 Steroid biosynthesis
    104662828 (TM7SF2)
Enzymes [BR:rro01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.70  Delta14-sterol reductase
     104662828 (TM7SF2)
SSDB
Motif
Pfam: ERG4_ERG24 DUF1295 ICMT PEMT
Other DBs
NCBI-GeneID: 104662828
NCBI-ProteinID: XP_010362244
UniProt: A0A2K6QL39
Position
15
AA seq 547 aa
MAPRLWSPAQWSPQAGVRTYLINVWPPPLACWAGLSRGGVSKLRLLRHPRRVRPRVPIGW
CAGPRMGRGRVHLKTLGQERSLSALGVQAGAGAAGPVPPRGRVHLLGNGADSVSLIDSCE
RPLSGGAETMAPPQGPRAPLEFGGPLGAAALLLLLPATMFHLLLAARSGPARLLGPPASL
PGLEALWSPRALLLWLAWLGLQAALYLLPARKVAEGQELKDKSRLRYPINGFQALVLTAL
LVGLGVSAGLPLGALPEMLLPLAFVATLTAFIFSLFLYMKAQVAPVSALAPGGNSGNPIY
DFFLGRELNPRICFFDFKYFCELRPGLIGWVLINLALLVKEAELRGSPSLAMWLVNGFQL
LYVGDALWHEEAVLTTMDITHDGFGFMLAFGDIAWVPFTYSLQAQFLLRHPQPLGLPMAS
AICLINAIGYYIFRGANSQKNTFRKNPSDPRVAGLETISTATGRKLLVSGWWGMVRHPNY
LGDLIMALAWSLPCGVSHLLPYFYLLYFTALLVHREARDERQCLQKYGLAWQEYCRRVPY
RIMPYIY
NT seq 1644 nt   +upstreamnt  +downstreamnt
atggcacccaggctctggtctccggcccagtggtccccgcaggcaggagtcaggacctac
ctaataaacgtgtggcctcctcctctcgcttgctgggcgggcctttccaggggcggggtt
tcgaagctgaggcttctgcggcacccgcgtcgagtccgcccccgagtgccgattggctgg
tgtgctgggcccagaatgggcagggggcgggtccacttaaaaaccctgggacaagagcgg
tccttgtctgcactcggtgttcaggcaggtgcaggcgccgcagggccggttcctccgcgc
ggccgagtccatctcctgggaaatggggcggacagtgtttccttgatcgacagttgtgag
cgccctctctccggcggagcggagaccatggccccccctcagggcccccgggccccgctg
gaattcggagggcccctgggcgccgcggctctgctgctgctgctgcccgccaccatgttc
cacctgctcctggcagcccgttcgggccccgcgcgcctgctgggtccacccgcgtccctg
cctgggctggaggcgctgtggagcccacgggcgctgctgctgtggctcgcctggctcggc
ctgcaggcggcgctctacctactgccggcgcgcaaggtggctgaggggcaggaattgaag
gacaagagtcgcctgcgctatcccattaacggcttccaggccctggtgctgacagccctg
ttggtggggctgggagtgtcagcggggctgcctctgggggcgctcccggagatgctcctg
cccttggcttttgtcgccaccctcaccgctttcatcttcagcctctttctctacatgaag
gcgcaggtagccccagtttcggccctggcacctggggggaactcaggcaatccgatttac
gacttttttctgggacgggagctcaaccctcgtatctgtttcttcgacttcaaatatttc
tgtgaactgcgacctggcctcattggctgggtcctcatcaacctggccctgttggtgaag
gaggcagaacttcggggcagtccctcactggccatgtggctggtcaatggcttccagtta
ctctatgtgggtgatgccctctggcacgaggaggccgtcctcaccaccatggatatcaca
catgacgggtttggcttcatgctggcatttggggacatagcctgggtgcccttcacctac
agcctgcaggcccagttcctgctgcgccacccgcagcctctggggttgcccatggcttct
gccatctgcctcatcaatgctattggttactacatcttccgtggggcgaattcccagaaa
aacactttccgaaagaatccttctgaccccagagtggctgggcttgagaccatctctaca
gccacagggcggaaactgctggtgtctgggtggtggggtatggtccgccatcccaactac
cttggagacctcatcatggctctggcttggtccttgccctgtggggtgtcacacctgctg
ccctacttctacctcctctacttcaccgcgctgctggtgcaccgtgaggcccgggatgag
cggcagtgcctgcagaagtacggcctggcctggcaggagtactgccggcgtgtgccttac
cgtatcatgccctacatctactga

DBGET integrated database retrieval system