KEGG   Rhinopithecus roxellana (golden snub-nosed monkey): 104663196Help
Entry
104663196         CDS       T03989                                 

Gene name
MTMR1
Definition
(RefSeq) myotubularin related protein 1
  KO
K18081  myotubularin-related protein 1/2 [EC:3.1.3.64 3.1.3.95]
Organism
rro  Rhinopithecus roxellana (golden snub-nosed monkey)
Pathway
rro00562  Inositol phosphate metabolism
rro01100  Metabolic pathways
rro04070  Phosphatidylinositol signaling system
Brite
KEGG Orthology (KO) [BR:rro00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    104663196 (MTMR1)
 09130 Environmental Information Processing
  09132 Signal transduction
   04070 Phosphatidylinositol signaling system
    104663196 (MTMR1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:rro01009]
    104663196 (MTMR1)
Enzymes [BR:rro01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.64  phosphatidylinositol-3-phosphatase
     104663196 (MTMR1)
    3.1.3.95  phosphatidylinositol-3,5-bisphosphate 3-phosphatase
     104663196 (MTMR1)
Protein phosphatases and associated proteins [BR:rro01009]
 Protein Tyrosine phosphatases (PTPs)
  Class I PTPs (Dual specificity phosphatases)
   Myotubularins
    104663196 (MTMR1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Myotub-related GRAM DSPc Y_phosphatase 3-PAP Y_phosphatase3 Myb_CC_LHEQLE
Motif
Other DBs
NCBI-GeneID: 104663196
NCBI-ProteinID: XP_010362621
Position
Un
AA seq 571 aa AA seqDB search
MEEAPLFPGESIKAIVKDVMYICPFMGAVSGTLTVTDFKLYFKNVERDPHFILDVPLGVI
SRVEKIGAQSHGDNSCGIEIVCKDMRNLRLAYKQEEQSKLGIFENLNKHAFPLSNGQALF
AFSYKEKFSINGWKVYDPVSEYKRQGLPNESWKISKINSNYEFCDTYPAIIVVPTSVKDD
DLSKVAAFRAKGRVPVLSWIHPESQATITRCSQPLVGPNDKRCKEDEKYLQIIMDANAQS
HKLIIFDARQNSVADTNKTKGGGYESESAYPNAELVFLEIHNIHVMRESLRKLKEIVYPS
IDEARWLSNVDGTHWLEYIRMLLAGAVRIADKIESGKTSVVVHCSDGWDRTAQLTSLAML
MLDSYYRTIKGFETLVEKEWISFGHRFALRVGHGNDNHADADRSPIFLQFIDCVWQMTRQ
FPSAFEFNELFLITILDHLYSCLFGTFLCNCEQQRFKEDVYTKTISLWSYINSQLDEFSN
PFFVNYENHVLYPVASLSHLELWVNYYVRWNPRMRPQMPIHQNLKELLAVRAELQKRVEG
LQREVATRAVSSSSERGSSPSHSATSVHTSV
NT seq 1716 nt NT seq  +upstreamnt  +downstreamnt
atggaagaggctccactttttccaggagaatcaattaaagccattgtgaaagatgtcatg
tatatctgcccatttatgggagcagtgagtggaaccctgacagtgacggactttaagctg
tacttcaaaaatgtcgaaagggacccacattttatccttgatgttccccttggagtgatc
agcagagttgagaagattggagcacagagccatggagacaattcctgtggtatagagata
gtgtgcaaggatatgaggaacttgcggcttgcttataaacaggaagaacagagtaaacta
gggatatttgaaaacctcaacaagcatgcatttcctctttctaatggacaggcactattt
gcattcagctataaagaaaaattttcaattaatggctggaaagtttatgatccagtatct
gaatataagagacagggtttgccaaatgagagttggaaaatatccaaaataaacagtaat
tatgagttctgtgacacctaccctgccatcattgttgtgccaactagtgtaaaagatgat
gacctttcaaaagtggcagcttttcgagcaaaaggcagagtccctgtgttgtcatggatt
catccagaaagtcaagcaacaattacccgctgcagccagccacttgtgggtcccaatgat
aagcgctgcaaagaggatgaaaaatatttgcaaataataatggatgctaacgcacagtca
cacaagcttatcatttttgatgctcgacaaaacagtgtcgctgataccaacaagacaaag
ggtggaggatatgaaagtgaaagtgcttacccaaacgcagaacttgtgttcttggagatc
cacaacattcatgtcatgcgagagtcactacgcaaattaaaagagattgtgtacccttca
atcgatgaggcacggtggctctccaatgtggatgggacgcattggctggaatatataagg
atgctgcttgctggggcagtaagaattgccgataaaatagaatccgggaaaacatctgtg
gtggtgcattgcagcgatggttgggaccgaacagcccagctcacatctctggctatgcta
atgttggacagttactacaggaccattaaaggatttgaaactctcgtagaaaaggagtgg
ataagctttggacacaggtttgcactgcgagtgggccatggtaatgacaaccatgctgat
gctgaccgatctcctatatttctgcagtttattgattgtgtttggcaaatgacaagacag
tttccttcagcattcgagtttaatgagctattcttgattacaattttggatcacctttat
agctgtctttttgggacctttttgtgcaactgtgaacagcagcgattcaaagaggatgta
tatacaaagacgatatctttatggtcgtatatcaatagccagctagatgagttttctaat
cccttctttgtgaattatgaaaaccacgtgttatatcctgttgctagtctgagtcatttg
gaattgtgggtaaactattatgtacgatggaatccacggatgagacctcagatgcccatt
caccagaatctcaaggagctgctggccgtcagggcggagctgcagaagcgtgtggagggc
ctacagcgggaggtggccacgcgtgccgtctcatcctcatctgagcggggctcctcgccc
tcccactctgccacctccgtccacacctcagtctga

DBGET integrated database retrieval system